DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXD4 and lbe

DIOPT Version :10

Sequence 1:NP_055436.2 Gene:HOXD4 / 3233 HGNCID:5138 Length:255 Species:Homo sapiens
Sequence 2:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster


Alignment Length:74 Identity:32/74 - (43%)
Similarity:46/74 - (62%) Gaps:0/74 - (0%)


- Green bases have known domain annotations that are detailed below.


Human   139 KVHVNSVNPNYTGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQ 203
            |.|::..:......:.::||||:|..|:.||||.|.:.:||:...|.|||.:|.||..|:..|||
  Fly   338 KSHLDIFSNRPQPKKKRKSRTAFTNHQIFELEKRFLYQKYLSPADRDEIAASLGLSNAQVITWFQ 402

Human   204 NRRMKWKKD 212
            |||.|.|:|
  Fly   403 NRRAKQKRD 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXD4NP_055436.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..127
Antp-type hexapeptide 133..138
Homeodomain 155..211 CDD:459649 28/55 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..255 1/1 (100%)
lbeNP_524435.2 Homeodomain 354..410 CDD:459649 28/55 (51%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.