DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXD4 and Ubx

DIOPT Version :9

Sequence 1:NP_055436.2 Gene:HOXD4 / 3233 HGNCID:5138 Length:255 Species:Homo sapiens
Sequence 2:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster


Alignment Length:273 Identity:82/273 - (30%)
Similarity:104/273 - (38%) Gaps:94/273 - (34%)


- Green bases have known domain annotations that are detailed below.


Human    63 GGSGPGPGSALPARGHGQEPGGPGGHYAAPGEPCPAPPAPPPAPLPGAR--AYSQSDPKQPPS-- 123
            ||.|.|.|.|....|.|...||...:......|....|..|.|..|.:|  .|..:....|.|  
  Fly   115 GGGGGGGGGAGGTGGAGNANGGNAANANGQNNPAGGMPVRPSACTPDSRVGGYLDTSGGSPVSHR 179

Human   124 -----------------------------GTALKQPAVV---------------------YPWM- 137
                                         |||......:                     |||| 
  Fly   180 GGSAGGNVSVSGGNGNAGGVQSGVGVAGAGTAWNANCTISGAAAQTAAASSLHQASNHTFYPWMA 244

Human   138 -----------KKVH---------------------VNSVNPNY--TGGEPKRSRTAYTRQQVLE 168
                       .|:.                     ..|:.|::  |.|..:|.|..|||.|.||
  Fly   245 IAGECPEDPTKSKIRSDLTQYGGISTDMGKRYSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTLE 309

Human   169 LEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKKD---HKLPNTKGRSSSSSSSSS 230
            ||||||.|.|||||||||:||.|||:||||||||||||||.||:   .|..|.:.:.:.:..:::
  Fly   310 LEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAIKELNEQEKQAQAQKAAA 374

Human   231 CSSSVAPSQ--HL 241
            .:::.|..|  ||
  Fly   375 AAAAAAAVQGGHL 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXD4NP_055436.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..127 21/96 (22%)
Antp-type hexapeptide 133..138 4/37 (11%)
Homeobox 157..210 CDD:306543 42/52 (81%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..255 6/35 (17%)
UbxNP_536752.1 Homeobox 299..352 CDD:395001 42/52 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.