Sequence 1: | NP_055436.2 | Gene: | HOXD4 / 3233 | HGNCID: | 5138 | Length: | 255 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_536752.1 | Gene: | Ubx / 42034 | FlyBaseID: | FBgn0003944 | Length: | 389 | Species: | Drosophila melanogaster |
Alignment Length: | 273 | Identity: | 82/273 - (30%) |
---|---|---|---|
Similarity: | 104/273 - (38%) | Gaps: | 94/273 - (34%) |
- Green bases have known domain annotations that are detailed below.
Human 63 GGSGPGPGSALPARGHGQEPGGPGGHYAAPGEPCPAPPAPPPAPLPGAR--AYSQSDPKQPPS-- 123
Human 124 -----------------------------GTALKQPAVV---------------------YPWM- 137
Human 138 -----------KKVH---------------------VNSVNPNY--TGGEPKRSRTAYTRQQVLE 168
Human 169 LEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKKD---HKLPNTKGRSSSSSSSSS 230
Human 231 CSSSVAPSQ--HL 241 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
HOXD4 | NP_055436.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 31..127 | 21/96 (22%) | |
Antp-type hexapeptide | 133..138 | 4/37 (11%) | |||
Homeobox | 157..210 | CDD:306543 | 42/52 (81%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 212..255 | 6/35 (17%) | |||
Ubx | NP_536752.1 | Homeobox | 299..352 | CDD:395001 | 42/52 (81%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000007 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.810 |