DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXD4 and ftz

DIOPT Version :9

Sequence 1:NP_055436.2 Gene:HOXD4 / 3233 HGNCID:5138 Length:255 Species:Homo sapiens
Sequence 2:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster


Alignment Length:194 Identity:76/194 - (39%)
Similarity:96/194 - (49%) Gaps:53/194 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    87 GHYAAPGEPCPAPPAPPPA--PLPGARAYSQSDPKQPP---SGTALKQPAVVYPWMKKVHVNS-- 144
            |.:|.|      ||..|.:  ||.|.     |.|.|.|   |.:|:.|           .:|.  
  Fly   186 GDFATP------PPTTPTSLPPLEGI-----STPPQSPGEKSSSAVSQ-----------EINHRI 228

Human   145 -VNPNYTGG---------------EPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCL 193
             ..||..|.               :.||:|..|||.|.||||||||||||:||||||:||:.|.|
  Fly   229 VTAPNGAGDFNWSHIEETLASDCKDSKRTRQTYTRYQTLELEKEFHFNRYITRRRRIDIANALSL 293

Human   194 SERQIKIWFQNRRMKWKKDHKLPNTKGRSSSSSS-------SSSCSSSVAPSQHLQPMAKDHHT 250
            |||||||||||||||.|||..|.::.....:..:       ::|.:::.|||..: ||...|.|
  Fly   294 SERQIKIWFQNRRMKSKKDRTLDSSPEHCGAGYTAMLPPLEATSTATTGAPSVPV-PMYHHHQT 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXD4NP_055436.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..127 14/44 (32%)
Antp-type hexapeptide 133..138 0/4 (0%)
Homeobox 157..210 CDD:306543 42/52 (81%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..255 10/46 (22%)
ftzNP_477498.1 FTZ 1..248 CDD:281812 20/83 (24%)
Homeobox 257..310 CDD:278475 42/52 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.