DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXD4 and Scr

DIOPT Version :9

Sequence 1:NP_055436.2 Gene:HOXD4 / 3233 HGNCID:5138 Length:255 Species:Homo sapiens
Sequence 2:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster


Alignment Length:260 Identity:99/260 - (38%)
Similarity:121/260 - (46%) Gaps:84/260 - (32%)


- Green bases have known domain annotations that are detailed below.


Human     8 VNSKYVDPKFPPCE------EYLQGGYLGEQGADYYGGGAQGADFQPPGLYPRPDFGEQPFGGSG 66
            ::::.:.||..|..      ..|..|.|         ||:..|.....||       .....|||
  Fly   210 LSTRDISPKLSPSSVVESVARSLNKGVL---------GGSLAAAAAAAGL-------NNNHSGSG 258

Human    67 PGPGSALPARGHGQEPGGPGG-----HYAAPGEPCPAPPAPPPAPLPGARAYSQSDP-----KQP 121
            ..              ||||.     |  :||               |..:.|:||.     ...
  Fly   259 VS--------------GGPGNVNVPMH--SPG---------------GGDSDSESDSGNEAGSSQ 292

Human   122 PSGTALKQPAVVYPWMKKVHV--NSVNPNYTGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRR 184
            .||...|.|..:|||||:||:  ::||.|   ||.||.||:|||.|.||||||||||||||||||
  Fly   293 NSGNGKKNPPQIYPWMKRVHLGTSTVNAN---GETKRQRTSYTRYQTLELEKEFHFNRYLTRRRR 354

Human   185 IEIAHTLCLSERQIKIWFQNRRMKWKKDHKLPNTKGRSSSSSSSSSCSSSVAPSQHLQPMAKDHH 249
            |||||.|||:|||||||||||||||||:||:               .|.::.| .|:.|....:|
  Fly   355 IEIAHALCLTERQIKIWFQNRRMKWKKEHKM---------------ASMNIVP-YHMGPYGHPYH 403

Human   250  249
              Fly   404  403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXD4NP_055436.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..127 21/105 (20%)
Antp-type hexapeptide 133..138 3/4 (75%)
Homeobox 157..210 CDD:306543 46/52 (88%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..255 7/38 (18%)
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 47/52 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I4116
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45771
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.