DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXD4 and unpg

DIOPT Version :9

Sequence 1:NP_055436.2 Gene:HOXD4 / 3233 HGNCID:5138 Length:255 Species:Homo sapiens
Sequence 2:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster


Alignment Length:314 Identity:72/314 - (22%)
Similarity:98/314 - (31%) Gaps:161/314 - (51%)


- Green bases have known domain annotations that are detailed below.


Human    82 PGGPGGHYA-----APGEPCPAPPAPP------------PAPL--------PGARAYSQSDPKQP 121
            |..|.||.|     |..:|.|.||.||            |.||        |.|...:.:|....
  Fly   111 PSSPAGHPAAQQPQAQAQPQPPPPHPPTHALEKQLPPTLPHPLDTRFLPFNPAAAGVAPTDLSYR 175

Human   122 PSGTALKQPAV----VYPWMK------KVHVNSVNP----------------------------- 147
            .....:.|..|    |:..::      ::|.:..||                             
  Fly   176 RLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPA 240

Human   148 --------------------------NYTG----------------------------------- 151
                                      ||.|                                   
  Fly   241 LDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGG 305

Human   152 -----------GEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNR 205
                       .:.:|.|||:|.:|:||||:|||..:||:...|.:||.:|.|||.|:|||||||
  Fly   306 KDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNR 370

Human   206 RMKWKK------DHKLPNTKGRSSSSSSSSSCSSSVAP-----------SQHLQ 242
            |.|||:      .|.|    ||:.::|.    :..|.|           |||.|
  Fly   371 RAKWKRVKAGLTSHGL----GRNGTTSG----TKIVVPIPVHVNRFAVRSQHQQ 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXD4NP_055436.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..127 18/69 (26%)
Antp-type hexapeptide 133..138 1/4 (25%)
Homeobox 157..210 CDD:306543 31/52 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..255 11/42 (26%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 30/50 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.