DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11158 and NSH5

DIOPT Version :9

Sequence 1:NP_572912.1 Gene:CG11158 / 32327 FlyBaseID:FBgn0030511 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_197388.1 Gene:NSH5 / 832005 AraportID:AT5G18870 Length:258 Species:Arabidopsis thaliana


Alignment Length:246 Identity:55/246 - (22%)
Similarity:94/246 - (38%) Gaps:75/246 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDKKHRLVVYDCDIGTDDAWGLAMLLRAEELTLREGRTCKVLAIT-TVHGNTDADNGTLNALRVL 64
            ::..||::: |.|:.|||...|..||:..:...      .::.|| :.:..|:|.:|..:...:|
plant    25 LNSPHRILL-DTDVDTDDFIALLYLLKLNKTEF------DLVGITLSANSWTNAGHGVNHIYDIL 82

  Fly    65 HTLNRRDVPVFRGCYESIVPRTWEYTNCFHGQDG--LNDVGNY-PVVDVE--------------- 111
            :.:.|.|:.|..|....|:            :||  |.|||:| |:::..               
plant    83 YMMGRDDITVGVGGEGGIL------------EDGTILPDVGDYLPIIEQGMTTAGGCRYRQSIPK 135

  Fly   112 ---QELQPEHAV--------NAMYR-----------LARANPGQVDFLLCGPLTNFANCINLYGN 154
               |::...:..        |..|.           :.:.:.|.:...:.|..||.|  :.:..|
plant   136 GRIQKIDSNYGFRKHFLPQGNRRYTPLEQPTAQKVIVDKVSEGPISIFVIGSHTNLA--LFMMSN 198

  Fly   155 SFLT-NIGRVYIMG------------GNIFGKGNVTKSAEFNFMMDPEAAH 192
            ..|. ||..:|:||            ||:|........||||...||.||:
plant   199 PHLKHNIQHIYVMGGSVRCQNPNGFCGNLFTDYTSNPYAEFNIFTDPFAAY 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11158NP_572912.1 nuc_hydro_CeIAG 6..328 CDD:239115 54/241 (22%)
NSH5NP_197388.1 nuc_hydro 42..>252 CDD:294156 48/228 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1957
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D824591at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.