DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11158 and NSH3

DIOPT Version :9

Sequence 1:NP_572912.1 Gene:CG11158 / 32327 FlyBaseID:FBgn0030511 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001330199.1 Gene:NSH3 / 832004 AraportID:AT5G18860 Length:890 Species:Arabidopsis thaliana


Alignment Length:364 Identity:91/364 - (25%)
Similarity:142/364 - (39%) Gaps:96/364 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VVYDCDIGTDDAWGLAMLLR--AEELTLREGRTCKVLAITTVHGNTDADNGTLNALRV------L 64
            ||:|.|:...|...|..||:  .:::.|:        ||..      :..|..||..:      |
plant   511 VVFDMDMSAGDFLSLFYLLKVPVDKIDLK--------AIIV------SPTGWANAATIDVVYDLL 561

  Fly    65 HTLNRRDVPV-----------------FRGC-YESIVPRTWEYTNC--FHGQDGL---------- 99
            |.:.|.|:||                 ..|| |...:||     .|  |...|.|          
plant   562 HMMGRDDIPVGLGDMLALNQSDPIFPPVGGCKYVKAIPR-----GCGGFLDSDTLYGLARDLPRS 621

  Fly   100 -------NDVGNYPVVDVEQ-ELQPEHAVNAMYRLARANPG--QVDFLLCGPLTNFANCINLYGN 154
                   |.|.:....|.:: ||:...|:.....|.::..|  ::..|..|||||.|..|:....
plant   622 PRRYTAENSVTHGAPRDTDRPELRQPLAIEVWQNLTKSGNGVSKITVLTNGPLTNLAKIISSDKK 686

  Fly   155 SFLTNIGRVYIMGGNI----FGKGNV-----TKSAEFNFMMDPEAAHITLERLLEPAIILPWEPC 210
            | .:.|..|||:||:|    ..|||:     ...||||..:||.||...||..|...::    |.
plant   687 S-SSLIKEVYIVGGHINREKSDKGNIFTIPSNAYAEFNMFLDPLAAKTVLESALNITLV----PL 746

  Fly   211 ID----GEFDTTLDWRLNVLGAVDHPFIE-LLTRVERSMLEPRGFVKWISCD----SLLTAAYLF 266
            ..    ..|.|.||...:.....:..|:: ||.|::....:.|   ::...|    .:|.|..|.
plant   747 ATQHKLSSFQTMLDRLYSSTKTPEARFVKRLLVRLQALHQKHR---RYTHIDMFLGEVLGAVLLG 808

  Fly   267 PD--AMIAEQRQYYATVELSGIHTR-GQMVLDHLRGRKV 302
            .|  ::..:.|..:..|...|..:| |::::|.|||:::
plant   809 GDDASLKPKMRAEHIKVIAEGDESRDGKILIDKLRGKQI 847

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11158NP_572912.1 nuc_hydro_CeIAG 6..328 CDD:239115 91/364 (25%)
NSH3NP_001330199.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1957
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D824591at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.