DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11158 and URH1

DIOPT Version :9

Sequence 1:NP_572912.1 Gene:CG11158 / 32327 FlyBaseID:FBgn0030511 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_565843.1 Gene:URH1 / 818204 AraportID:AT2G36310 Length:336 Species:Arabidopsis thaliana


Alignment Length:193 Identity:65/193 - (33%)
Similarity:93/193 - (48%) Gaps:18/193 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KHRLVVYDCDIGTDDAWGLAMLLRAEELTLREGRTCKVLAITTVHGNTDADNGTLNALRVLHTLN 68
            ||..::.|.|.|.||:..:.|..:..||        ::|.:|||.||....:.|.|||.:.....
plant    20 KHEKLIIDTDPGIDDSMAILMAFQTPEL--------EILGLTTVFGNVSTQDATRNALLLCEIAG 76

  Fly    69 RRDVPVFRGCYESI---VPRTWEYTNCFHGQDGLNDVGNYPVVDVEQELQPEHAVNAMYRLARAN 130
            ..||||..|..|.:   :||..::.   ||::||.||...|....:.|   :.|...:.......
plant    77 FPDVPVAEGSSEPLKGGIPRVADFV---HGKNGLGDVSLPPPSRKKSE---KSAAEFLDEKVEEY 135

  Fly   131 PGQVDFLLCGPLTNFANCINLYGNSFLTNIGRVYIMGGNIFGKGNVTKSAEFNFMMDPEAAHI 193
            ||:|..|..|||||.|..|. ..:||.:.:.::.|:||..|..|||..:||.|...|||||.:
plant   136 PGEVTILALGPLTNLALAIK-RDSSFASKVKKIVILGGAFFSLGNVNPAAEANIYGDPEAADV 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11158NP_572912.1 nuc_hydro_CeIAG 6..328 CDD:239115 63/191 (33%)
URH1NP_565843.1 PLN02717 22..336 CDD:178319 63/191 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 92 1.000 Domainoid score I2577
eggNOG 1 0.900 - - E1_COG1957
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I2205
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D824591at2759
OrthoFinder 1 1.000 - - FOG0001175
OrthoInspector 1 1.000 - - mtm991
orthoMCL 1 0.900 - - OOG6_100640
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X724
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.730

Return to query results.
Submit another query.