DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12177 and URH2

DIOPT Version :9

Sequence 1:NP_001285222.1 Gene:CG12177 / 32326 FlyBaseID:FBgn0030510 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_563745.1 Gene:URH2 / 837068 AraportID:AT1G05620 Length:322 Species:Arabidopsis thaliana


Alignment Length:194 Identity:64/194 - (32%)
Similarity:95/194 - (48%) Gaps:30/194 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ILDCDGGSDDAWALLLLLHAAKSHGIHLLAITTMGCGNTSRENAARNMRRILDACKRTDIPIYLG 92
            |:|.|.|.|||.|:.:.|::.:   :.::.:||: .||.....|.||...:|:...|||||:..|
plant    10 IIDTDPGIDDAMAIFVALNSPE---VDVIGLTTI-FGNVYTTLATRNALHLLEVAGRTDIPVAEG 70

  Fly    93 AVDALIPSLEDEK----KYFHGRDGFGD-CLTDDCALQLED------IVQAEHAVTAIHDLCRSR 146
            .....   |.|.|    .:.||:||.|: .........:|.      :.||:        ||   
plant    71 THKTF---LNDTKLRIADFVHGKDGLGNQNFPPPKGKPIEKSGPEFLVEQAK--------LC--- 121

  Fly   147 PKQITIFAVGPLTNLALGYTMYGPEFGNNFRDLFIMGGNYQGVGNSSRSAEFNFHSDPEAAHTV 210
            |.:||:.|:||||||||...: .|||..|...:.::||.:...||.:.::|.|...|||||..|
plant   122 PGEITVVALGPLTNLALAVQL-DPEFSKNVGQIVLLGGAFAVNGNVNPASEANIFGDPEAADIV 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12177NP_001285222.1 nuc_hydro_CeIAG 25..347 CDD:239115 64/194 (33%)
URH2NP_563745.1 PLN02717 7..322 CDD:178319 64/194 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 92 1.000 Domainoid score I2577
eggNOG 1 0.900 - - E1_COG1957
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I2205
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D824591at2759
OrthoFinder 1 1.000 - - FOG0001175
OrthoInspector 1 1.000 - - mtm991
orthoMCL 1 0.900 - - OOG6_100640
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X724
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.730

Return to query results.
Submit another query.