DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12177 and NSH5

DIOPT Version :9

Sequence 1:NP_001285222.1 Gene:CG12177 / 32326 FlyBaseID:FBgn0030510 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_197388.1 Gene:NSH5 / 832005 AraportID:AT5G18870 Length:258 Species:Arabidopsis thaliana


Alignment Length:229 Identity:63/229 - (27%)
Similarity:90/229 - (39%) Gaps:45/229 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SPRYAILDCDGGSDDAWALLLLLHAAKSHGIHLLAITTMGCGNTSRENAARNMRRILDACKRTDI 87
            ||...:||.|..:||..|||.||...|:. ..|:.||......|:..:...::..||....|.||
plant    27 SPHRILLDTDVDTDDFIALLYLLKLNKTE-FDLVGITLSANSWTNAGHGVNHIYDILYMMGRDDI 90

  Fly    88 PIYLGAVDALIPS---LEDEKKYF----HGRDGFGDC-------------LTDDCALQLEDIVQA 132
            .:.:|....::..   |.|...|.    .|....|.|             :..:...:...:.|.
plant    91 TVGVGGEGGILEDGTILPDVGDYLPIIEQGMTTAGGCRYRQSIPKGRIQKIDSNYGFRKHFLPQG 155

  Fly   133 EHAVT---------AIHDLCRSRPKQITIFAVGPLTNLALGYTMYGPEFGNNFRDLFIMGG---- 184
            ....|         .|.|.....|  |:||.:|..||||| :.|..|...:|.:.:::|||    
plant   156 NRRYTPLEQPTAQKVIVDKVSEGP--ISIFVIGSHTNLAL-FMMSNPHLKHNIQHIYVMGGSVRC 217

  Fly   185 -NYQG-VGN------SSRSAEFNFHSDPEAAHTV 210
             |..| .||      |:..||||..:||.||:.|
plant   218 QNPNGFCGNLFTDYTSNPYAEFNIFTDPFAAYQV 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12177NP_001285222.1 nuc_hydro_CeIAG 25..347 CDD:239115 61/227 (27%)
NSH5NP_197388.1 nuc_hydro 42..>252 CDD:294156 56/214 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1957
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D824591at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.