DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12177 and NSH3

DIOPT Version :9

Sequence 1:NP_001285222.1 Gene:CG12177 / 32326 FlyBaseID:FBgn0030510 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001330199.1 Gene:NSH3 / 832004 AraportID:AT5G18860 Length:890 Species:Arabidopsis thaliana


Alignment Length:353 Identity:80/353 - (22%)
Similarity:127/353 - (35%) Gaps:102/353 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GEGVAAAPSPRYAIL-DCDGGSDDAWALLLLLHAAKSHGIHLLAITTMGCGNTSRENAARNMRRI 78
            |:.:....|..:.|| |.|..:||.:|:|.||...||. ..|:.||......|:..:|...:..:
plant    21 GQNLPCVLSSSHRILVDTDVDTDDLFAILYLLKLNKSE-FDLVGITLSANAWTNAGHAVNQVYDL 84

  Fly    79 LDACKRTDIPIYLG-----AVDALIPSLEDEKKYF----HGRDGFGDC---------------LT 119
            |....|.|||:.:|     :.|..|.|  |...||    .|....|:|               :.
plant    85 LHMMDRDDIPVGVGGEGGISDDGTIHS--DVGGYFPIIEQGMTTTGECRYRQAIPKGLGGLLDID 147

  Fly   120 DDCALQLEDIVQAEHAVT---------AIHDLCRSRPKQITIFAVGPLTNLALGYTMYGPEFGNN 175
            .:...:.:.:.|.....|         .|.|.....|  .|:..:|..||.|| :.|..|...:|
plant   148 SNYGFRKQFLPQGNRRYTPLQQPTAQKVIVDKISEGP--TTVILLGSHTNFAL-FLMSNPHLKHN 209

  Fly   176 FRDLFIMGGNYQG--------------------VGN---------SSRSAEFNFHSDPEAAHTVL 211
            .:.::||||..:.                    .||         |:..:|||..:||.||:.| 
plant   210 IQHIYIMGGGVRSQNPTGCCPANSTVAECQPRQCGNRGNLFTDYTSNPYSEFNIFADPFAAYQV- 273

  Fly   212 LRTRCPITILPWEACLPERFNIHINWRLKDFAARAKEAGHPAITMLNQVE---AAQWLPMIEQYG 273
            ..:..|:|::|.:|    ...|.||.:..:             |..|..:   .||::.:..:..
plant   274 FHSGVPVTLVPLDA----TNTIPINQKFFE-------------TFENNYQRTYEAQYVFLSLKIA 321

  Fly   274 IDTWNPCDAIAVAVWLFEDHLIRRHNTW 301
            .|||            |:|...:.:..|
plant   322 RDTW------------FDDEFYKSYFMW 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12177NP_001285222.1 nuc_hydro_CeIAG 25..347 CDD:239115 78/343 (23%)
NSH3NP_001330199.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1957
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D824591at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.