DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12177 and URH1

DIOPT Version :9

Sequence 1:NP_001285222.1 Gene:CG12177 / 32326 FlyBaseID:FBgn0030510 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_565843.1 Gene:URH1 / 818204 AraportID:AT2G36310 Length:336 Species:Arabidopsis thaliana


Alignment Length:237 Identity:70/237 - (29%)
Similarity:117/237 - (49%) Gaps:27/237 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VENGRGGGGEGVAAAPSPRYAILDCDGGSDDAWALLLLLHAAKSHGIHLLAITTMGCGNTSRENA 71
            :||..||...|.......: .|:|.|.|.||:.|:|:   |.::..:.:|.:||: .||.|.::|
plant     5 MENCNGGISNGDVLGKHEK-LIIDTDPGIDDSMAILM---AFQTPELEILGLTTV-FGNVSTQDA 64

  Fly    72 ARNMRRILDACKRTDIPIYLGAVDAL---IPSLEDEKKYFHGRDGFGDCLTDDCALQLEDIVQAE 133
            .||...:.:.....|:|:..|:.:.|   ||.:.|   :.||::|.||......:.:..:...||
plant    65 TRNALLLCEIAGFPDVPVAEGSSEPLKGGIPRVAD---FVHGKNGLGDVSLPPPSRKKSEKSAAE 126

  Fly   134 HAVTAIHDLCRSRPKQITIFAVGPLTNLALGYTMYGPEFGNNFRDLFIMGGNYQGVGNSSRSAEF 198
            .    :.:.....|.::||.|:||||||||.... ...|.:..:.:.|:||.:..:||.:.:||.
plant   127 F----LDEKVEEYPGEVTILALGPLTNLALAIKR-DSSFASKVKKIVILGGAFFSLGNVNPAAEA 186

  Fly   199 NFHSDPEAAHTVLLRTRCPITILPWEACLPERFNIHINWRLK 240
            |.:.||||| .|:..:...||::          .|:|..:||
plant   187 NIYGDPEAA-DVVFTSGADITVV----------GINITTQLK 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12177NP_001285222.1 nuc_hydro_CeIAG 25..347 CDD:239115 65/219 (30%)
URH1NP_565843.1 PLN02717 22..336 CDD:178319 65/220 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 92 1.000 Domainoid score I2577
eggNOG 1 0.900 - - E1_COG1957
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I2205
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D824591at2759
OrthoFinder 1 1.000 - - FOG0001175
OrthoInspector 1 1.000 - - mtm991
orthoMCL 1 0.900 - - OOG6_100640
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X724
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.730

Return to query results.
Submit another query.