DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12177 and SPBC800.11

DIOPT Version :9

Sequence 1:NP_001285222.1 Gene:CG12177 / 32326 FlyBaseID:FBgn0030510 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_595113.1 Gene:SPBC800.11 / 2540496 PomBaseID:SPBC800.11 Length:389 Species:Schizosaccharomyces pombe


Alignment Length:324 Identity:70/324 - (21%)
Similarity:115/324 - (35%) Gaps:106/324 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 AAPSPRYAILDCDGGSDDAWALLLLLHAAKSHGIHLLAITTMGCGNTSRENAARNMRRILDACKR 84
            ||.:....|:|.||.:|  ..:|..|.|.:    .:|.:|.: .|:.:.:::......:|.....
pombe    20 AASAASKVIIDNDGLTD--LQVLFALQAKQ----QILGVTAI-YGDYTLDDSLFLASDVLSTGNL 77

  Fly    85 T-DIPIYLGAVDALI-----------------------PSLE----DEKKYFHGRDGFGDCLTDD 121
            | .||.:.||...|:                       |..|    :.:.|.:.        |..
pombe    78 TYCIPSFAGAAQPLLRTNNTFQIWQELYGSYVWQGYWQPEYETANTNNESYIYN--------TQI 134

  Fly   122 CALQLEDIVQAEHAVTAIHDLCRSRPKQITIFAVGPLTNLALGYTMYGPEFGNNFRDLFIMGGNY 186
            .|.|.            |.|:.::.|.:|||.|.||:||||:..::: |:...|.:.|.||||..
pombe   135 SAAQF------------IIDMVKANPNEITIVAAGPMTNLAIALSIW-PDLAKNTKSLVIMGGYV 186

  Fly   187 -----QGVGN---SSRSAEFNFHSDPEAAHTVLLRTRCPITILPWEACLPERFNIHINWRLKDFA 243
                 |..|.   :...::||...:||||.|.                      |..:|.....|
pombe   187 DSQIAQVTGGDFLNDMYSDFNLFMEPEAAQTA----------------------ITADWPELIIA 229

  Fly   244 ARAKEAGHPAITMLN----------QVEAAQWLPMIEQY-GIDT--------WNPCDAIAVAVW 288
            .......:|:.::.|          .:|:...|...:|: |..|        |:.. |.|:|.|
pombe   230 GNITSQVYPSQSLYNGIIARAGGMANIESDSGLSYAKQFVGNGTLPSGSFPFWDEV-ASAIAAW 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12177NP_001285222.1 nuc_hydro_CeIAG 25..347 CDD:239115 68/319 (21%)
SPBC800.11NP_595113.1 nuc_hydro_CjNH 26..351 CDD:239120 68/318 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1957
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.