DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11164 and AT4G20325

DIOPT Version :9

Sequence 1:NP_001285220.1 Gene:CG11164 / 32323 FlyBaseID:FBgn0030507 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001078412.2 Gene:AT4G20325 / 5008148 AraportID:AT4G20325 Length:277 Species:Arabidopsis thaliana


Alignment Length:251 Identity:63/251 - (25%)
Similarity:103/251 - (41%) Gaps:49/251 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PGHGKEALFITHPDGR-----------MMELVAFTEPRRSWFVDSEVCSNGRIYMTAPVDPTFLA 110
            ||   |.|.:.||...           :.||..|.:...|||:...:..:|.:||..||||.|:.
plant    28 PG---ELLTLRHPKSENGTCFLFNNEMLQELQWFKQSYGSWFLGDYISEDGSLYMATPVDPVFIL 89

  Fly   111 LHHLRKHCAQRAISLDNIAVEEASTS---RLLNEIL----DPGNL-------KC---VADVKSSG 158
            |.           ..|...:::...|   |.|:|||    .||..       ||   |...:..|
plant    90 LP-----------IFDEARMKKGENSGKFRQLDEILFVEGYPGYQHLLSLAEKCMEIVCQTQEVG 143

  Fly   159 EQKFYKYNQERTLAWLALKTRQVAKILKEKQVHCGHSAQSQNFVRSEKLVAENVSNEMDYTRMAC 223
            ..|||:.:..:.||||:.|...:...|.|...:.....:.|..|.|..:|.|.:..| .:.::..
plant   144 SMKFYRLDNSKVLAWLSCKIYCLKNSLPELDKNYAAQDEKQTLVDSVSIVGEYLKTE-PWLKLLY 207

  Fly   224 DYVG-RYLDADLHGLLTSYLHIPSEIQAIVEEKAASQKRKSVAGKNEGSDSKKIKL 278
            |::| :::|..:..  |:..::|:   |.....|:|...:..|.|..|..:|:.|:
plant   208 DHLGLKFVDPTMKE--TNMENLPT---ANENNMASSNSIQEKANKKPGKQTKQAKV 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11164NP_001285220.1 RNase_H2-B 39..338 CDD:187751 63/251 (25%)
AT4G20325NP_001078412.2 RNase_H2-B 15..185 CDD:187751 44/170 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4705
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I2545
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1092212at2759
OrthoFinder 1 1.000 - - FOG0005677
OrthoInspector 1 1.000 - - oto3338
orthoMCL 1 0.900 - - OOG6_104396
Panther 1 1.100 - - LDO PTHR13383
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.830

Return to query results.
Submit another query.