DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAlig4 and Y73B6BL.14

DIOPT Version :9

Sequence 1:NP_572907.1 Gene:DNAlig4 / 32322 FlyBaseID:FBgn0030506 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_500970.2 Gene:Y73B6BL.14 / 190650 WormBaseID:WBGene00022237 Length:93 Species:Caenorhabditis elegans


Alignment Length:92 Identity:16/92 - (17%)
Similarity:35/92 - (38%) Gaps:28/92 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 LHPKAQDIYQRCSDLGHVCNLLADRTTDLDASSSKDSKAAVKFVN--LNSVIRPFHQIRPMLCER 263
            ||.|.:..:.:..::..:|:||         .|..|::.....::  |.|             :.
 Worm     4 LHLKGKSKFNKFHEIFDICSLL---------ESCPDNRGKTDVISTLLGS-------------DN 46

  Fly   264 FPGDIQELMQSDVLYLETKMDGERFQL 290
            |.||:...::    :|..:.|..::.|
 Worm    47 FDGDLLLWLR----FLIRESDPRKYNL 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNAlig4NP_572907.1 DNA_ligase_A_N 10..197 CDD:282522
dnl1 84..613 CDD:273147 16/92 (17%)
Adenylation_DNA_ligase_IV 249..466 CDD:185713 6/42 (14%)
OBF_DNA_ligase_IV 469..607 CDD:153437
BRCT 668..745 CDD:214602
Y73B6BL.14NP_500970.2 DNA_ligase_A_N 14..>88 CDD:377398 13/82 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1793
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.