powered by:
Protein Alignment tth and ESA1
DIOPT Version :9
| Sequence 1: | NP_001285216.1 |
Gene: | tth / 32318 |
FlyBaseID: | FBgn0030502 |
Length: | 428 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_014887.3 |
Gene: | ESA1 / 854418 |
SGDID: | S000005770 |
Length: | 445 |
Species: | Saccharomyces cerevisiae |
| Alignment Length: | 41 |
Identity: | 14/41 - (34%) |
| Similarity: | 19/41 - (46%) |
Gaps: | 8/41 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 224 EWFYDDMDMNDVDSLEEPKSPADDEYDYDPRYGNKKRRKRR 264
||...|....|.:.| .||..|.|| .|||::|::
Yeast 65 EWITTDRINLDKEVL-YPKLKATDE-------DNKKQKKKK 97
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| tth | NP_001285216.1 |
Requiem_N |
24..94 |
CDD:290758 |
|
| ESA1 | NP_014887.3 |
SAS2 |
16..431 |
CDD:227360 |
14/41 (34%) |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
1 |
0.930 |
- |
- |
|
C157345439 |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.
