DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tth and SFP1

DIOPT Version :9

Sequence 1:NP_001285216.1 Gene:tth / 32318 FlyBaseID:FBgn0030502 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_013507.1 Gene:SFP1 / 851119 SGDID:S000004395 Length:683 Species:Saccharomyces cerevisiae


Alignment Length:229 Identity:44/229 - (19%)
Similarity:76/229 - (33%) Gaps:70/229 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 NLGLSSLTSGVGSMPGSNSLASSSSLTLNMLTGGGAAPAVLGSLHSDTAH----DFNGAFSLEES 185
            |:..|:.|:...:   ..|:.|||:..:: :......|::|.:.:||:::    ||||..::.: 
Yeast    11 NMATSTTTTATSA---HASINSSSNFNID-IDSNQNTPSILINNNSDSSNGKNTDFNGVNNIHQ- 70

  Fly   186 SSLGAAGGDTSDSKDSQQQQHQQHQHQQQAVKEELLPKEWFYDDMDMNDVDSLEEPKSPADDEYD 250
                         |:.....:..|.:....:.:.||..:         |:..|.. :|.|..:  
Yeast    71 -------------KNIMNNTNNVHLYSPNIMDQTLLTPQ---------DIAKLRR-ESIAHSQ-- 110

  Fly   251 YDPRYGNKKRRKRRPGKRGGDSGGGGGGGGAGGGGNSGGS-----SSSRRRSAAARSRITTTDAA 310
                                      |.||...|..|.||     ..|||.|....|......||
Yeast   111 --------------------------GMGGVSWGSISVGSWLRDEIISRRNSIVPASANGAASAA 149

  Fly   311 LDASLEA-----IESGESVPGSNGGPISSGGILS 339
            ..|:..|     |:.....|..:..|...|..:|
Yeast   150 ASATTTATNTLQIQQPTKRPSVSNPPYHRGYSIS 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tthNP_001285216.1 Requiem_N 24..94 CDD:290758
SFP1NP_013507.1 SFP1 43..683 CDD:227516 37/193 (19%)
C2H2 Zn finger 600..629 CDD:275368
C2H2 Zn finger 661..683 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3744
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.