DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment tth and ATXR5

DIOPT Version :9

Sequence 1:	NP_001285216.1	Gene:	tth / 32318	FlyBaseID:	FBgn0030502	Length:	428	Species:	Drosophila melanogaster
Sequence 2:	NP_001078559.1	Gene:	ATXR5 / 830839	AraportID:	AT5G09790	Length:	379	Species:	Arabidopsis thaliana

Alignment Length:	69	Identity:	17/69 - (24%)
Similarity:	30/69 - (43%)	Gaps:	8/69 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly    90 RKSRRQYLSKMYSRFPERPFQALRKEHEALVASGVNLGLSSLTSGVGSMPGSNSLASSSSLTLNM 154
            :|.||:.|..:.|..|::....:.....||.|.|:     ..:.|:..:||   :|..|:....:
plant   160 KKRRRKLLPLVPSEDPDQRLAQMGTLASALTALGI-----KYSDGLNYVPG---MAPRSANQSKL 216

  Fly   155 LTGG 158
            ..||
plant   217 EKGG 220

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
tth	NP_001285216.1	Requiem_N	24..94	CDD:290758	1/3 (33%)
ATXR5	NP_001078559.1	PHD_SF	66..111	CDD:389947
ATXR5	NP_001078559.1	SET_ATXR5_6-like	242..379	CDD:380937
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0001297
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.000