DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tth and DPF1

DIOPT Version :9

Sequence 1:NP_001285216.1 Gene:tth / 32318 FlyBaseID:FBgn0030502 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_011525658.1 Gene:DPF1 / 8193 HGNCID:20225 Length:407 Species:Homo sapiens


Alignment Length:254 Identity:70/254 - (27%)
Similarity:97/254 - (38%) Gaps:98/254 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 YRETIEYSANFNTRLCSERRHRLPFLDPQTGVAQNHSQLFLDKRQRMPGFRQGQIYTYPAARWRK 91
            |||.||:..::|.|||:||..||||||.|||||||:..::::|..|.||...||||||||..|||
Human    43 YREAIEHCRSYNARLCAERSLRLPFLDSQTGVAQNNCYIWMEKTHRGPGLAPGQIYTYPARCWRK 107

  Fly    92 SRRQYLSK-------MYSRFPERPFQALRKEHEALVASGVNLGLSSLTSGVGSMPGSNSLASSSS 149
            .||..:.:       .|....|.|   |:||                    |.:|          
Human   108 KRRLNILEDPRLRPCEYKIDCEAP---LKKE--------------------GGLP---------- 139

  Fly   150 LTLNMLTGGGAAPAVLGSLHSDTAHDFNGAFSLEESSSLGAAGGDTSDSKDSQQQQHQQHQHQQQ 214
                      ..|.:...|.::|...   ...|:|..::          .|.|:||..:..|   
Human   140 ----------EGPVLEALLCAETGEK---KIELKEEETI----------MDCQKQQLLEFPH--- 178

  Fly   215 AVKEELLPKEWFYDDMDMNDVDSLEEPKSPADDEYDYDPRYGNKKRRKRRPGKRGGDSG 273
                          |:::.|::             |..||     |:.|..||..|..|
Human   179 --------------DLEVEDLE-------------DDIPR-----RKNRAKGKAYGIGG 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tthNP_001285216.1 Requiem_N 24..94 CDD:290758 39/66 (59%)
DPF1XP_011525658.1 Requiem_N 39..105 CDD:404861 36/61 (59%)
SFP1 <212..246 CDD:227516
PHD1_DPF1 279..336 CDD:277160
PHD2_d4 337..392 CDD:277005
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156489
Domainoid 1 1.000 92 1.000 Domainoid score I7594
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D312433at33208
OrthoFinder 1 1.000 - - FOG0001297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X895
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.