DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tth and Kat5

DIOPT Version :9

Sequence 1:NP_001285216.1 Gene:tth / 32318 FlyBaseID:FBgn0030502 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001349301.1 Gene:Kat5 / 81601 MGIID:1932051 Length:546 Species:Mus musculus


Alignment Length:238 Identity:50/238 - (21%)
Similarity:69/238 - (28%) Gaps:119/238 - (50%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LAKIESFLKDVSYRET--IEYSANFNTRLCSERRHRLPFLDPQTGVAQNHSQLFLDK-------- 69
            ||:|.| :||:|.|:.  :.| .:||.|           ||...    .|.:|.|.|        
Mouse    61 LAEILS-VKDISGRKLFYVHY-IDFNKR-----------LDEWV----THERLDLKKIQFPKKEA 108

  Fly    70 ----RQRMPGFRQGQIYTYPAARWRKSRRQYLSKMYSRFPERPFQA------------------- 111
                :..:||.|.|.                        |||...|                   
Mouse   109 KTPTKNGLPGSRPGS------------------------PEREVPASAQASGKTLPIPVQITLRF 149

  Fly   112 -LRKEHEALVASGVNLGLSSLT---------------------------------------SGVG 136
             |.||.||:.....:..|||.:                                       ..|.
Mouse   150 NLPKEREAIPGGEPDQPLSSSSCLQPNHRSTKRKVEVVSPATPVPSETAPASVFPQNGSARRAVA 214

  Fly   137 SMPG----SNSLASSSSLTLNMLTGGGAAPAVLGSLHSDTAHD 175
            :.||    ||.|.:... :.:...|..:||.:.|||.||.:||
Mouse   215 AQPGRKRKSNCLGTDED-SQDSSDGIPSAPRMTGSLVSDRSHD 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tthNP_001285216.1 Requiem_N 24..94 CDD:290758 17/83 (20%)
Kat5NP_001349301.1 Tudor-knot 40..98 CDD:403041 16/53 (30%)
PLN00104 76..537 CDD:215056 42/222 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846906
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.