DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tth and Dpf3

DIOPT Version :9

Sequence 1:NP_001285216.1 Gene:tth / 32318 FlyBaseID:FBgn0030502 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001254554.1 Gene:Dpf3 / 70127 MGIID:1917377 Length:378 Species:Mus musculus


Alignment Length:280 Identity:81/280 - (28%)
Similarity:110/280 - (39%) Gaps:103/280 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LKDVSYRETIEYSANFNTRLCSERRHRLPFLDPQTGVAQNHSQLFLDKRQRMPGFRQGQIYTYPA 86
            |.|..|:|.||:..::|:|||:||..||||||.|||||||:..::::||.|.||...||:|||||
Mouse    12 LGDQFYKEAIEHCRSYNSRLCAERSVRLPFLDSQTGVAQNNCYIWMEKRHRGPGLAPGQLYTYPA 76

  Fly    87 ARWRKSRRQYLSKMYSRFPERPFQALRKEHEALVASGVNLGLSSLTSGVGSMPGSNSLASSSSLT 151
            ..|||.||.:.       ||.|                .|.|..:...| .:|......:|.|.|
Mouse    77 RCWRKKRRLHP-------PEDP----------------KLRLLEIKPEV-ELPLKKDGFTSESTT 117

  Fly   152 LN-MLTGGGAAPAVLGSLHSDTAHDFNGAFSLEESSSLGAAGGDTSDSKDSQQQQHQQHQHQQQA 215
            |. :|.|.|....|                                   |:::::..|   :.|.
Mouse   118 LEALLRGEGVEKKV-----------------------------------DAREEESIQ---EIQR 144

  Fly   216 VKEELLPKEWFYDDMDMNDVDSLEEPKSPADDEYDYDPRYGNKKRRKRRPGKRGGDSGGGGGGGG 280
            |.|              || :::||.....|.|.|.      .||:.|..|:..|.:||      
Mouse   145 VLE--------------ND-ENVEEGNEEEDLEEDV------PKRKNRTRGRARGSAGG------ 182

  Fly   281 AGGGGNSGGSSSSRRRSAAA 300
                         |||..||
Mouse   183 -------------RRRHDAA 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tthNP_001285216.1 Requiem_N 24..94 CDD:290758 39/69 (57%)
Dpf3NP_001254554.1 Requiem_N 13..84 CDD:372894 39/70 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..193 20/84 (24%)
SFP1 <195..222 CDD:227516
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 225..254
PHD1_DPF3 261..317 CDD:277162
PHD2_d4 318..363 CDD:277005
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846918
Domainoid 1 1.000 92 1.000 Domainoid score I7580
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D312433at33208
OrthoFinder 1 1.000 - - FOG0001297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X895
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.900

Return to query results.
Submit another query.