DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tth and DPF2

DIOPT Version :9

Sequence 1:NP_001285216.1 Gene:tth / 32318 FlyBaseID:FBgn0030502 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_024304405.1 Gene:DPF2 / 5977 HGNCID:9964 Length:575 Species:Homo sapiens


Alignment Length:475 Identity:121/475 - (25%)
Similarity:167/475 - (35%) Gaps:174/475 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 NLAKIESFLKDVSYRETIEYSANFNTRLCSERRHRLPFLDPQTGVAQNHSQLFLDKRQRMPGFRQ 78
            |:.|:   |.:..|::.:|...|:|.|||:||..||||||.||||||::..::::||.|.||...
Human     7 NVVKL---LGEQYYKDAMEQCHNYNARLCAERSVRLPFLDSQTGVAQSNCYIWMEKRHRGPGLAS 68

  Fly    79 GQIYTYPAARWRKSRRQYLSKMYSRFPERP-----------FQALRKEHEALVASGVNLGLSSLT 132
            ||:|:|||.||||.||.:.       ||.|           .|.|:||                 
Human    69 GQLYSYPARRWRKKRRAHP-------PEDPRLSFPSIKPDTDQTLKKE----------------- 109

  Fly   133 SGVGSMPGSN--SLASSSSLTLNMLTGGGAAPAVLGSLHSDTAHDFNGAFSLEESSSLGAAGGDT 195
             |:.|..||:  :|..:..|...    |...|.|        ..|..|.|.:..|.:        
Human   110 -GLISQDGSSLEALLRTDPLEKR----GAPDPRV--------DDDSLGEFPVTNSRA-------- 153

  Fly   196 SDSKDSQQQQHQQHQHQQQAVKEELLPKEWFYDDMDMNDVDSLEEPKSPADDEYDYDPRYGNKKR 260
                                 ::.:|..:.|.||:|              |::|:.|    ..||
Human   154 ---------------------RKRILEPDDFLDDLD--------------DEDYEED----TPKR 179

  Fly   261 RKRRPGKRGGDSGGGGGGGGAGGGGNSGGSS--SSRRRSAAARSRITTT---DAALD-ASLEAIE 319
            |    ||      |...|.|.|.......:|  ..|.:..|..|...|:   |.||| |....:.
Human   180 R----GK------GKSKGKGVGSARKKLDASILEDRDKPYACDSECLTSGWVDLALDPAPALDMR 234

  Fly   320 SGESV--------------PGS---------------NGG---------PISSGGILSGSLGAGL 346
            .|..|              |..               .||         |.|..|:|.|:. ||.
Human   235 GGRVVFLPRVLKQTWALVLPADCFRLRPLGGLGPCYMTGGTCMLWERFLPSSGVGLLVGAT-AGR 298

  Fly   347 AGVSGSGGGGGASGASANSRRSRGAGTRGRRRAKGPN------SAVGASCDPT----SP-GMVIE 400
            .|:|..|        ...|......|.||...:...:      ||:...|..|    || |.:..
Human   299 VGLSTDG--------LQVSWPQLSQGPRGLTLSFSTSVLFFFLSALPHFCPSTLGAPSPLGFLSR 355

  Fly   401 PPSFESAAAAVGVVEDANAH 420
            ...|.:|||.|..|...::|
Human   356 LLCFPAAAAPVSSVSRPSSH 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tthNP_001285216.1 Requiem_N 24..94 CDD:290758 36/69 (52%)
DPF2XP_024304405.1 Requiem_N 13..79 CDD:316564 32/65 (49%)
SFP1 <397..417 CDD:227516
PHD1_DPF2_like 456..511 CDD:277161
PHD2_d4 513..558 CDD:277005
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156487
Domainoid 1 1.000 92 1.000 Domainoid score I7594
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3744
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D312433at33208
OrthoFinder 1 1.000 - - FOG0001297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X895
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.