DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tth and phf10

DIOPT Version :9

Sequence 1:NP_001285216.1 Gene:tth / 32318 FlyBaseID:FBgn0030502 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_012818532.1 Gene:phf10 / 595031 XenbaseID:XB-GENE-940958 Length:541 Species:Xenopus tropicalis


Alignment Length:153 Identity:36/153 - (23%)
Similarity:63/153 - (41%) Gaps:32/153 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AKIESFLKDVSYRETIEYSANFNTRLCSERRHRLPFLDPQTGVAQNHSQLFLDKRQRMPGFRQGQ 80
            :|:..::|..: ::..|:::|.|.....|||   .:.|.||.|.    |:...|.:.:|. ...:
 Frog   235 SKVPEYIKKAA-KKAAEFNSNLNRERMEERR---AYFDLQTHVI----QVPQGKYKILPS-EMTK 290

  Fly    81 IYTYPAA-----------RWRKSRRQYL---SKMYSRFPERPFQALRKEHEALVASGVNLGLSSL 131
            :..||.:           |:..:..:||   :.:|    |.|...|..|...|.:.|.    |..
 Frog   291 VSPYPVSLIPGQFQEYYKRYSPNELRYLPLNTALY----EPPLDPLDPELLTLDSDGD----SDE 347

  Fly   132 TSGVGSMPGSNSLASSSSLTLNM 154
            ...|.|....|.::|.|| ::||
 Frog   348 VEEVKSEKKKNKVSSDSS-SVNM 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tthNP_001285216.1 Requiem_N 24..94 CDD:290758 16/80 (20%)
phf10XP_012818532.1 PHD1_PHF10 422..476 CDD:277003
PHD2_PHF10 478..521 CDD:277004
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D312433at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.