DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tth and dpf1

DIOPT Version :9

Sequence 1:NP_001285216.1 Gene:tth / 32318 FlyBaseID:FBgn0030502 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001314998.1 Gene:dpf1 / 566219 ZFINID:ZDB-GENE-050913-31 Length:407 Species:Danio rerio


Alignment Length:294 Identity:78/294 - (26%)
Similarity:115/294 - (39%) Gaps:102/294 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSAVNIQIVSMPNLAKIESFLKDVSYRETIEYSANFNTRLCSERRHRLPFLDPQTGVAQNHSQL 65
            |::.|...:.|..:...|::.|.:..|||.||:..::|.|||:||..||||||.||||||::..:
Zfish    27 MATVVQNPLKSQSSGTVIKNSLGEEFYREAIEHCRSYNARLCAERSMRLPFLDSQTGVAQSNCYI 91

  Fly    66 FLDKRQRMPGFRQGQIYTYPAARWRKSRRQYLSKMYSRFPERPFQ-----ALRKEHEALVASGVN 125
            :::|..|.||...||:|||||..|||.||..:.: ..|.....|:     ||:||          
Zfish    92 WMEKTHRGPGVAPGQLYTYPARCWRKKRRLNILE-DPRLGPIEFKIDYEAALKKE---------- 145

  Fly   126 LGLSSLTSGVGSMPGSNSLASSSSLTLNMLTGGGAAPAVLGSLHSDTAHDFNGAFSLEESSSLGA 190
                                           ||.....||.||.|                    
Zfish   146 -------------------------------GGVPDGPVLESLLS-------------------- 159

  Fly   191 AGGDTSDSKDSQQQQHQQHQHQQQAVKEELLPKEWFYDDMDMNDVD------------------S 237
              |:..|.|...:::....:.|:..:.|       |..::||.:::                  .
Zfish   160 --GELLDKKVETKEEEPMSECQKLLMGE-------FPHELDMEEMEEDVPKRKNRTKGRACGIGG 215

  Fly   238 LEEPKSPADDEYDYDPRY-----GNKKRRKRRPG 266
            :.:.:.||..| |.|..|     |  ||.|.|||
Zfish   216 MRKRQDPASLE-DRDKPYVCDICG--KRYKNRPG 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tthNP_001285216.1 Requiem_N 24..94 CDD:290758 37/69 (54%)
dpf1NP_001314998.1 Requiem_N 49..120 CDD:290758 37/70 (53%)
C2H2 Zn finger 234..253 CDD:275368 7/15 (47%)
PHD1_DPF1 289..346 CDD:277160
PHD2_d4 347..392 CDD:277005
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592118
Domainoid 1 1.000 92 1.000 Domainoid score I7563
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D312433at33208
OrthoFinder 1 1.000 - - FOG0001297
OrthoInspector 1 1.000 - - otm26601
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X895
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.