DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tth and PHF10

DIOPT Version :9

Sequence 1:NP_001285216.1 Gene:tth / 32318 FlyBaseID:FBgn0030502 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_060758.2 Gene:PHF10 / 55274 HGNCID:18250 Length:498 Species:Homo sapiens


Alignment Length:209 Identity:41/209 - (19%)
Similarity:74/209 - (35%) Gaps:47/209 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AKIESFLKDVSYRETIEYSANFNTRLCSERRHRLPFLDPQTGVAQNHSQLFLDKRQRMPGFRQGQ 80
            :|:..::|..: ::..|:::|.|.....|||   .:.|.||.|.|            :|   ||:
Human   194 SKVPEYIKKAA-KKAAEFNSNLNRERMEERR---AYFDLQTHVIQ------------VP---QGK 239

  Fly    81 IYTYPAARWRKSRRQYLSKMYSRFPERPFQALRKEHEALVASGVNLGLSSLTSGVGSMPGSNSLA 145
            ....|..|.:.|     |...:..|.: ||...|.:     |...|....|.:.:...|....| 
Human   240 YKVLPTERTKVS-----SYPVALIPGQ-FQEYYKRY-----SPDELRYLPLNTALYEPPLDPEL- 292

  Fly   146 SSSSLTLNMLTGGGAAPAVLGSLHSDTAHDFNGAFSLEESSSLGAAGGDTSDSKDSQQQQHQQHQ 210
                            ||:.....||...|..|....:...:..::.|:.|:.:.....|....|
Human   293 ----------------PALDSDGDSDDGEDGRGDEKRKNKGTSDSSSGNVSEGESPPDSQEDSFQ 341

  Fly   211 HQQQAVKEELLPKE 224
            .:|::..:...|::
Human   342 GRQKSKDKAATPRK 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tthNP_001285216.1 Requiem_N 24..94 CDD:290758 17/69 (25%)
PHF10NP_060758.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62
SAY 89..295 30/147 (20%)
Essential to induce neural progenitor proliferation. /evidence=ECO:0000250 89..185
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 285..368 14/88 (16%)
Essential to induce neural progenitor proliferation. /evidence=ECO:0000250 292..334 9/58 (16%)
PHD1_PHF10 379..433 CDD:277003
PHD2_PHF10 435..478 CDD:277004
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D312433at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.