DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tth and Dpf1

DIOPT Version :10

Sequence 1:NP_572904.1 Gene:tth / 32318 FlyBaseID:FBgn0030502 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_038944303.1 Gene:Dpf1 / 50545 RGDID:61868 Length:455 Species:Rattus norvegicus


Alignment Length:80 Identity:44/80 - (55%)
Similarity:56/80 - (70%) Gaps:3/80 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IESFLKDVS---YRETIEYSANFNTRLCSERRHRLPFLDPQTGVAQNHSQLFLDKRQRMPGFRQG 79
            |::.||.:.   |||.||:..::|.|||:||..||||||.|||||||:..::::|..|.||...|
  Rat    44 IQNPLKSLGEDFYREAIEHCRSYNARLCAERSLRLPFLDSQTGVAQNNCYIWMEKTHRGPGLAPG 108

  Fly    80 QIYTYPAARWRKSRR 94
            |||||||..|||.||
  Rat   109 QIYTYPARCWRKKRR 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tthNP_572904.1 DPF1-3_N 24..89 CDD:464074 36/67 (54%)
Dpf1XP_038944303.1 DPF1-3_N 52..118 CDD:464074 36/65 (55%)
SFP1 <249..277 CDD:227516
PHD1_DPF1 327..384 CDD:277160
PHD2_d4 385..440 CDD:277005
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.