DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tth and e(y)3

DIOPT Version :9

Sequence 1:NP_001285216.1 Gene:tth / 32318 FlyBaseID:FBgn0030502 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001259719.1 Gene:e(y)3 / 32965 FlyBaseID:FBgn0087008 Length:2012 Species:Drosophila melanogaster


Alignment Length:480 Identity:88/480 - (18%)
Similarity:138/480 - (28%) Gaps:173/480 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 TYPAARWRKSRRQYLSKMYSRFPERPFQALRKEHEALVASGVNLGLSSLTSG-----VGSMPGSN 142
            |.||..:..:..:..|..|.:..||           |:|:|...|..|:.:.     ||.:|.:|
  Fly   638 TAPAKSFTTTTPKSKSSKYPQLTER-----------LMANGSGTGGGSVIAAESEAVVGPLPAAN 691

  Fly   143 SLASSSSLTLNMLTGGGAAPAV---------LGSLHSDTAH---------------DFNGAFSLE 183
            . |.|...::.:|.....:|.|         :.:.|..|.|               |.|....|:
  Fly   692 P-AQSIIESIEILDTPDGSPRVAYMDEDSNPMLNKHLQTIHKLAMDHGVEQRMDTQDNNNENHLK 755

  Fly   184 ESSSLGAAGGDTS---------DSKDSQQQQHQQH---------------QHQQQAVKEE----- 219
            .::|.|.....:.         |:.::.||....|               .|:.:..|.|     
  Fly   756 RTNSEGNESPSSRLPPSKQRRLDNDENDQQTQNCHDPARKCSESLQALPPSHRSRKQKHERILNT 820

  Fly   220 -----LLP--KEWFYDDMDMNDVDSLE------------EPKSPADDEYDYDPRYGNKKRRKRRP 265
                 |.|  ::......|.|...|.|            ||.:|...........|.|:.|.:|.
  Fly   821 DLEGSLFPPTQQQSISTPDQNGALSSEVEGEDAKAQDPLEPATPQPPPVATPAGTGKKRGRPKRI 885

  Fly   266 GKRGGDSGGGGGGGGAGGGGNSGGSSSSRRRSAAARSRITTTDAAL------------------- 311
            ..:....|||......|.......|:...||....|.|:.....::                   
  Fly   886 QNQSSPDGGGAVTPKPGTPQEEANSAVKSRRVQLLRKRLAIDMVSVGQEQADMKAKEKESSVGVP 950

  Fly   312 -----DASLEAIES--------------------------------------------------- 320
                 |...|.:||                                                   
  Fly   951 NARVEDGLAETLESPKTRDHRPLRATRRTTTSTNTNLQPTPKSTRKRQSKASVQQSQLPPPTMAQ 1015

  Fly   321 -GESVPGSNGGPISSGGILSGSLGAGLAGVSGSGGGGGASGASANSRRSRGAGTRGRRRAKGPNS 384
             |.|...||....||   :|.:|.|.:.....|.....:|||:||.:...|:|:....    |.:
  Fly  1016 FGSSESESNNNNNSS---ISFALSAQIDLTMCSSSSSTSSGAAANQQVIGGSGSSSML----PPT 1073

  Fly   385 AVGASCDPTSPGMVIEPPSFESAAA 409
            .:.:|.||. |.::.:|..|.|..|
  Fly  1074 TILSSSDPL-PDVIFQPNDFSSIMA 1097

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tthNP_001285216.1 Requiem_N 24..94 CDD:290758 3/10 (30%)
e(y)3NP_001259719.1 PHD_SF 1700..1754 CDD:304600
RanBP2-type Zn finger 1700..1725 CDD:275375
RanBP2-type Zn finger 1749..1775 CDD:275375
PHD2_PHF10 1756..1799 CDD:277004
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463885
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105037at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.