DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tth and dpf2l

DIOPT Version :9

Sequence 1:NP_001285216.1 Gene:tth / 32318 FlyBaseID:FBgn0030502 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_997861.2 Gene:dpf2l / 326933 ZFINID:ZDB-GENE-030131-5132 Length:405 Species:Danio rerio


Alignment Length:294 Identity:84/294 - (28%)
Similarity:123/294 - (41%) Gaps:86/294 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSAVNIQIVSMPNLAKIESFLKDVSYRETIEYSANFNTRLCSERRHRLPFLDPQTGVAQNHSQL 65
            |::||.       |:.|:   |.:..|::.:|...|:|.|||:||...:||||.||||||::..:
Zfish     1 MATAVE-------NIVKV---LGEQYYKDALEQCHNYNARLCAERSILMPFLDSQTGVAQSNCYI 55

  Fly    66 FLDKRQRMPGFRQGQIYTYPAARWRKSRRQYLSKMYSRFPERPFQALRKEHEALV-----ASGVN 125
            :::||.|..|...||:|:|||.||||.||.:.       ||.|         |||     .:.:.
Zfish    56 WMEKRHRSAGTAPGQLYSYPARRWRKKRRAHP-------PEDP---------ALVFPPLKTAELE 104

  Fly   126 LGLSSLTSGVGSMPGSNSLASSSSLTLNMLTGGGAAPAVLGSLHSDTAHDFNGAFSLEESSSLGA 190
            |||..  ..:|.:.||:..|        :|.|......|...|...           ||.:||..
Zfish   105 LGLKK--DVLGPLDGSSLEA--------LLKGEPLDKRVTTELRPP-----------EEETSLAE 148

  Fly   191 AGGDTSDSKDSQQQQHQQHQHQQQAVKEELLPKEWFYDDMDMNDVDSLEEPK------------- 242
            ..|.::.|..|...:          :::.:|..|.:.||:|..|.:. |.||             
Zfish   149 ITGTSTASSHSGSTR----------IRKRILEPEDYLDDLDDEDFEE-ETPKRRSKGKSKGRGVG 202

  Fly   243 -------SPADDEYDYDPRYGNK---KRRKRRPG 266
                   :.|..:.|.|..|...   ||.|.|||
Zfish   203 NGKKKLEAAAAAQEDRDKPYACDICGKRYKNRPG 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tthNP_001285216.1 Requiem_N 24..94 CDD:290758 33/69 (48%)
dpf2lNP_997861.2 Requiem_N 13..79 CDD:290758 29/65 (45%)
Peptidase_C19 222..>244 CDD:271592 7/15 (47%)
PHD1_DPF2_like 284..339 CDD:277161
PHD2_d4 341..386 CDD:277005
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592114
Domainoid 1 1.000 92 1.000 Domainoid score I7563
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D312433at33208
OrthoFinder 1 1.000 - - FOG0001297
OrthoInspector 1 1.000 - - otm26601
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X895
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.