DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tth and mof

DIOPT Version :9

Sequence 1:NP_001285216.1 Gene:tth / 32318 FlyBaseID:FBgn0030502 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_511051.1 Gene:mof / 31518 FlyBaseID:FBgn0014340 Length:827 Species:Drosophila melanogaster


Alignment Length:175 Identity:40/175 - (22%)
Similarity:71/175 - (40%) Gaps:44/175 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 QALRKEHE-------ALVASG-----VNLGLSSLTSGVGSMPGSNSLASSSSLTLNMLTGGGAA- 161
            |.:.:|||       |....|     |....:.|::.: .:.||:. ::..||.|:.:....|| 
  Fly    18 QPIEEEHEPEQEPTDAYTIGGPPRTPVEDAAAELSASL-DVSGSDQ-SAEQSLDLSGVQAEAAAE 80

  Fly   162 ---PAVLGSLHSD---TAHDFNGAFSLEESSSLGAAGG---DTSDSKDS-QQQQHQQHQHQQQAV 216
               ||  ...|.|   .:.|...|.|...||:..::..   |.|::::: .:.:.:|.|.|||..
  Fly    81 SEPPA--KRQHRDISPISEDSTPASSTSTSSTRSSSSSRYDDVSEAEEAPPEPEPEQPQQQQQEE 143

  Fly   217 KEELLPKEWFYDDMDMNDVDSLEEPKSPADDEYD-YDPRYGNKKR 260
            |:|                |..::.|||...|.: .:|....|::
  Fly   144 KKE----------------DGQDQVKSPGPVELEAQEPAQPQKQK 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tthNP_001285216.1 Requiem_N 24..94 CDD:290758
mofNP_511051.1 Tudor-knot 382..432 CDD:288553
NAT_SF 528..813 CDD:302625
MOZ_SAS 599..778 CDD:280097
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463882
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.