DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tth and Rsf1

DIOPT Version :9

Sequence 1:NP_001285216.1 Gene:tth / 32318 FlyBaseID:FBgn0030502 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_218939.4 Gene:Rsf1 / 308839 RGDID:1311245 Length:1448 Species:Rattus norvegicus


Alignment Length:357 Identity:70/357 - (19%)
Similarity:115/357 - (32%) Gaps:106/357 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LCSERRHRLPFLDPQTGVAQNHSQLFLDKRQRM---------------PGFRQGQIYTYPAARWR 90
            ||.:...:|..||    ||....:....:::|:               |.|.:.|......|:..
  Rat   947 LCEKLEEQLQDLD----VALKKKERAERRKERLVYVGISIENIIPPQEPEFSEDQEEKKKDAKKS 1007

  Fly    91 KSR---------RQYLSKMYSRFPERPFQALRKEHEALVASGVNLG--LSSLTSGVGSMPGS--- 141
            |:.         |:.:|..:..|.|...:|:..:.:.....||..|  :|::|...|....:   
  Rat  1008 KANVLERRSTRTRKCISYRFDEFDEAIDEAIEDDIKEADGGGVGRGKDISTITGHRGKDISTILD 1072

  Fly   142 -----------------------NSLASSSSLTLN------MLTGGGAAPAVLGSLHSDTAHDFN 177
                                   |.|.|.|:|...      .::.|.....|:.        |.|
  Rat  1073 EERKENKRPQRAAAARRKKRRRLNDLDSDSNLDEEESEDEFKISDGSQDEFVVS--------DEN 1129

  Fly   178 GAFSLEESSSLGAAGGDTSDSK--DSQQQQHQQHQHQQQAVKEELLPKEWFYDDMDMNDVDSLEE 240
            ...|.||..|     .:.||:.  ..:.::|.....:|.........|:.:.||.:..:.:..|.
  Rat  1130 PDESEEEPPS-----NEDSDTDFCSRRLRRHPSRPMRQSRRLRRKTQKKKYSDDDEEEEEEEEES 1189

  Fly   241 PKSPADDEYDYDPRYGN-----KKRRKRRPGKR----GGDSGGGGGGGGAGGGGNSGGSSSSRRR 296
            .::..|.|.|:...:.:     ::||.||..||    ..||             .|.||..|.||
  Rat  1190 EENSRDSESDFSDDFSDEFVETRRRRSRRNQKRQINYKEDS-------------ESDGSQKSLRR 1241

  Fly   297 SAAARSRITTTDAALDASLEAIESGESVPGSN 328
            ....| |:.      ...|.:.||.||....|
  Rat  1242 GKEIR-RVH------KRRLSSSESEESYMSKN 1266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tthNP_001285216.1 Requiem_N 24..94 CDD:290758 13/76 (17%)
Rsf1XP_218939.4 WHIM1 102..152 CDD:292246
WHIM2 154..186 CDD:292247
PHD_RSF1 897..942 CDD:277018
BAH 919..>972 CDD:295389 7/28 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350415
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.