DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tth and Dpf1

DIOPT Version :9

Sequence 1:NP_001285216.1 Gene:tth / 32318 FlyBaseID:FBgn0030502 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_006540095.1 Gene:Dpf1 / 29861 MGIID:1352748 Length:437 Species:Mus musculus


Alignment Length:265 Identity:78/265 - (29%)
Similarity:108/265 - (40%) Gaps:75/265 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IESFLKDVS---YRETIEYSANFNTRLCSERRHRLPFLDPQTGVAQNHSQLFLDKRQRMPGFRQG 79
            |::.||.:.   |||.||:..::|.|||:||..||||||.|||||||:..::::|..|.||...|
Mouse    44 IQNPLKSLGEDFYREAIEHCRSYNARLCAERSLRLPFLDSQTGVAQNNCYIWMEKTHRGPGLAPG 108

  Fly    80 QIYTYPAARWRKSRRQYLSK-------MYSRFPERPFQALRKEHEALVASGVNLGLSSLTSGVGS 137
            |||||||..|||.||..:.:       .|....|.|   |:||                    |.
Mouse   109 QIYTYPARCWRKKRRLNILEDPRLRPCEYKIDCEAP---LKKE--------------------GG 150

  Fly   138 MPGSNSLASSSSLTLNMLTGGGAAPAVLGSLHSDTAHDFNGAFSLEESSSLGAAGGDTSDSKDSQ 202
            :|                    ..|.:...|.::|...   ...|:|..::          .|.|
Mouse   151 LP--------------------EGPVLEALLCAETGEK---KVELKEEETI----------MDCQ 182

  Fly   203 QQQHQQHQHQQQAVK-EELLPKEWFYDDMDMNDVDSLEEPKSPADDEYDYDPRY-----GNKKRR 261
            :||..:..|..:... ||.:|:...........:..|.:.:..|..| |.|..|     |  ||.
Mouse   183 KQQLLEFPHDLEVEDLEEDIPRRKNRARGKAYGIGGLRKRQDTASLE-DRDKPYVCDICG--KRY 244

  Fly   262 KRRPG 266
            |.|||
Mouse   245 KNRPG 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tthNP_001285216.1 Requiem_N 24..94 CDD:290758 39/72 (54%)
Dpf1XP_006540095.1 Requiem_N 52..123 CDD:372894 39/70 (56%)
SFP1 <225..259 CDD:227516 12/28 (43%)
PHD1_DPF1 309..366 CDD:277160
PHD2_d4 367..422 CDD:277005
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846912
Domainoid 1 1.000 92 1.000 Domainoid score I7580
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X895
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.890

Return to query results.
Submit another query.