DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tth and dpff-1

DIOPT Version :9

Sequence 1:NP_001285216.1 Gene:tth / 32318 FlyBaseID:FBgn0030502 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_498281.2 Gene:dpff-1 / 175832 WormBaseID:WBGene00016200 Length:372 Species:Caenorhabditis elegans


Alignment Length:295 Identity:57/295 - (19%)
Similarity:98/295 - (33%) Gaps:117/295 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LKDVSYRETIEYSANFNTRLCSERRHRL--PFLDPQTGVAQNHSQLFLDKRQRM-PGFRQGQIYT 83
            :.:..|.:.:.....:|:|...:|:.||  |:.:.||..||..|:........| |......:..
 Worm     2 ISENGYMDLMRNCIKWNSRQMEDRKKRLRFPYYEHQTATAQRESRFTTRNVDHMYPSNDPNTVVQ 66

  Fly    84 YPAARWRKSRRQYLS-----KMYSRFPERPFQALRKEHEALVASGVNLGLSSLTSGVGSMPGSNS 143
            :...||:||:.|..|     .|:.|  |.|              .:.:.:..||           
 Worm    67 FATERWKKSKSQPPSDAVEMSMFLR--ENP--------------SIQVAIDHLT----------- 104

  Fly   144 LASSSSLTLNMLTGGGAAPAVLGSLHSDTAHDFNGAFSLEESSSLGAAGGDTSDSKDSQQQQHQQ 208
                              |.|:|                ..:.|:..:..|::..:.|:|.|   
 Worm   105 ------------------PQVVG----------------PTTESVSDSSNDSTTIRPSRQTQ--- 132

  Fly   209 HQHQQQAVKEELLPKEWFYDDMDMNDVDSLEEPKSPADDEYDYDPRYGNKKRRKRRPGKRGGDSG 273
                   :|||      :.||..::|..|.:|..|..||       :.::||||           
 Worm   133 -------IKEE------YRDDYVLDDELSPDEFGSDEDD-------WSSRKRRK----------- 166

  Fly   274 GGGGGGGAGGGGNSG---GSSSSRRRSAAARSRIT 305
                       ||.|   .::|||::....||.::
 Worm   167 -----------GNLGPVQKATSSRKKVPTTRSSVS 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tthNP_001285216.1 Requiem_N 24..94 CDD:290758 18/72 (25%)
dpff-1NP_498281.2 Requiem_N 3..77 CDD:290758 18/73 (25%)
SFP1 <19..236 CDD:227516 55/278 (20%)
PHD1_MOZ_d4 257..311 CDD:277001
PHD2_d4 313..358 CDD:277005
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157630
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3744
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D312433at33208
OrthoFinder 1 1.000 - - FOG0001297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X895
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.