DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tth and dpf3

DIOPT Version :9

Sequence 1:NP_001285216.1 Gene:tth / 32318 FlyBaseID:FBgn0030502 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_012823348.1 Gene:dpf3 / 100125167 XenbaseID:XB-GENE-6067294 Length:387 Species:Xenopus tropicalis


Alignment Length:340 Identity:98/340 - (28%)
Similarity:132/340 - (38%) Gaps:106/340 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LKDVSYRETIEYSANFNTRLCSERRHRLPFLDPQTGVAQNHSQLFLDKRQRMPGFRQGQIYTYPA 86
            |.|..|::.||:..::|:|||:||..||||||.|||||||:..::::||.|.||...||:|||||
 Frog    12 LGDQFYKDAIEHCRSYNSRLCAERSVRLPFLDSQTGVAQNNCYIWMEKRHRGPGMAPGQLYTYPA 76

  Fly    87 ARWRKSRRQYLSKMYSRFPERPFQALRKEHEALVASGVNLGLSSLTSGVGSMPGSNSLASSSSLT 151
            ..|||.||.:.       ||.|...|.:     :.|.|:..|..          .|.||..::|.
 Frog    77 RCWRKKRRLHP-------PEDPRLRLLE-----IKSDVDFPLRK----------DNVLAEGTTLE 119

  Fly   152 LNMLTGGG----------AAPAVLGSLHSD-TAHDFNGAFSLEE------SSSLGAAGG-----D 194
            . :|.|.|          :...:...|.:| .|.|.||...:||      :.|.|.|.|     |
 Frog   120 A-LLRGEGIEKKDVRDEESLQEIQRVLENDENADDANGEDDIEEEVPKRKNRSRGRARGGRRRND 183

  Fly   195 TS-DSKD-------SQQQQHQQ-------------------HQHQQQAVKEELLPKEWFYDDMDM 232
            || |..|       |.:|:|..                   |........||         ..|.
 Frog   184 TSLDEHDKPYVCDNSYKQKHNSKTADKVCGKRYKNRPGLSYHYAHTHLADEE---------GTDC 239

  Fly   233 NDVDSLEEPKSPADDEYDYDPRYGNKKRRKRRPGKRGGDSGGGGGGGGAGGGGN----SGGSSSS 293
            .|.|: ..|.||:      ..|..|:|.||              |..||....|    ..|.||.
 Frog   240 RDQDT-RSPSSPS------AIRNENQKPRK--------------GTDGAILSNNYCDFCLGDSSI 283

  Fly   294 RRRSAAARSRITTTD 308
            .::|......::..|
 Frog   284 NKKSGQPEELVSCAD 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tthNP_001285216.1 Requiem_N 24..94 CDD:290758 38/69 (55%)
dpf3XP_012823348.1 Requiem_N 13..84 CDD:290758 38/70 (54%)
PHD1_DPF3 273..329 CDD:277162 5/26 (19%)
PHD2_d4 330..375 CDD:277005
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 94 1.000 Domainoid score I7328
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D312433at33208
OrthoFinder 1 1.000 - - FOG0001297
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X895
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.