DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tth and dpf1

DIOPT Version :9

Sequence 1:NP_001285216.1 Gene:tth / 32318 FlyBaseID:FBgn0030502 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_012823267.1 Gene:dpf1 / 100036731 XenbaseID:XB-GENE-922864 Length:410 Species:Xenopus tropicalis


Alignment Length:123 Identity:52/123 - (42%)
Similarity:64/123 - (52%) Gaps:30/123 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 YRETIEYSANFNTRLCSERRHRLPFLDPQTGVAQNHSQLFLDKRQRMPGFRQGQIYTYPAARWRK 91
            |||.||:..::|.|||:||..||||||.|||||||:..::::|..|.||...||||||||..|||
 Frog    39 YREAIEHCRSYNARLCAERSMRLPFLDSQTGVAQNNCYIWMEKTHRGPGLSPGQIYTYPARCWRK 103

  Fly    92 SRR------------------QYLSKMYSRFPERP-FQAL-----------RKEHEAL 119
            .||                  :...|..|..||.| .:||           .||.||:
 Frog   104 KRRLDILEDPRLRPCEFKLDYEVPMKKESSLPEGPVLEALLCAETVDKKLDLKEEEAV 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tthNP_001285216.1 Requiem_N 24..94 CDD:290758 39/66 (59%)
dpf1XP_012823267.1 Requiem_N 35..106 CDD:372894 39/66 (59%)
SFP1 <214..242 CDD:227516
PHD_SF 292..349 CDD:389947
PHD2_d4 350..395 CDD:277005
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 94 1.000 Domainoid score I7328
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D312433at33208
OrthoFinder 1 1.000 - - FOG0001297
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X895
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.