DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BthD and AT4G31360

DIOPT Version :9

Sequence 1:NP_572903.3 Gene:BthD / 32317 FlyBaseID:FBgn0030501 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_194864.2 Gene:AT4G31360 / 829263 AraportID:AT4G31360 Length:186 Species:Arabidopsis thaliana


Alignment Length:119 Identity:35/119 - (29%)
Similarity:56/119 - (47%) Gaps:14/119 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KRNKKAEAP------IAERDAGEELDPNAPVLYVEHCRSURVFRRRAEELHSALRERGLQQLQLQ 62
            |:.::.|.|      ..|::..|..||....:.:|||:....|:.||.::..|| |..:..:.:.
plant    72 KKEEEVEEPEEAVEEEVEKEEPEVEDPTRTKIVIEHCKQCNAFKTRAIQVKEAL-EGAVPGVTVS 135

  Fly    63 LNALGAPRRGAFELSLSAGGMGKQEQVALWSGLKRGPPRARKFPTVEEVYDRIV 116
            ||. ..||||.||:....|    |..::|.. :|| |....|...:|||.:.|:
plant   136 LNP-EKPRRGCFEIREEGG----QTFISLLE-MKR-PFAPMKALDMEEVIEDII 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BthDNP_572903.3 TP53IP5 <125..>216 CDD:291976
AT4G31360NP_194864.2 Rdx 103..183 CDD:294841 28/88 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008474
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR33638
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.970

Return to query results.
Submit another query.