DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BthD and AT2G24440

DIOPT Version :10

Sequence 1:NP_572903.3 Gene:BthD / 32317 FlyBaseID:FBgn0030501 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_565570.1 Gene:AT2G24440 / 816980 AraportID:AT2G24440 Length:183 Species:Arabidopsis thaliana


Alignment Length:125 Identity:35/125 - (28%)
Similarity:54/125 - (43%) Gaps:22/125 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KRNKKAEAPI------------AERDAGEELDPNAPVLYVEHCRSURVFRRRAEELHSALRERGL 56
            |:.||.|..:            ||::  |:.|.:...:.:|||:..:.|:.||.|:...| |..:
plant    65 KKVKKEEVAVKIEKEEEEDDDAAEKE--EDDDSDKKKIVIEHCKQCKSFKERANEVKEGL-EEAV 126

  Fly    57 QQLQLQLNALGAPRRGAFELSLSAGGMGKQEQVALWSGLKRGPPRARKFPTVEEVYDRIV 116
            ..:.:.:|. ..||||.||:....|     |.......:|| |....|...:|||...||
plant   127 PGIIVTVNP-DKPRRGCFEIREEGG-----ETFISLLAMKR-PFTPMKELNMEEVIADIV 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BthDNP_572903.3 PLN02967 144..>240 CDD:215521
AT2G24440NP_565570.1 Rdx 100..>146 CDD:470191 16/47 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.