DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BthD and CG13186

DIOPT Version :9

Sequence 1:NP_572903.3 Gene:BthD / 32317 FlyBaseID:FBgn0030501 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_610725.1 Gene:CG13186 / 36294 FlyBaseID:FBgn0033680 Length:143 Species:Drosophila melanogaster


Alignment Length:147 Identity:43/147 - (29%)
Similarity:72/147 - (48%) Gaps:22/147 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPPKRNKKAEAPIAERDAGEELDPNAPVLYVEHCRSURVFRRRAEELHSALRERGLQQLQLQL-- 63
            ||||:..|.:..: :..:.|....:..::|:||.....:|:.:|:|..:...:| :.:.:.||  
  Fly     1 MPPKKPAKKKKDV-DWSSDEHFSKDRSMIYIEHTYECPIFQTKADECGTFFTQR-IPERKFQLVK 63

  Fly    64 --NALGAPRRGAFELSLSAGGMGKQEQVALWSGLKRGPPRARKFP------------TVEEVY-D 113
              |....||.||||:..|..  .:..:..|||||::||||..|||            .:::.| |
  Fly    64 NRNGRQVPREGAFEIGFSQN--ARTSEHLLWSGLEKGPPRRDKFPLDYEALVPDVNRILKKFYPD 126

  Fly   114 RIVGI-LGDQQESKEQI 129
            :.||: ..|..|.||.:
  Fly   127 KAVGVDADDGDEEKEDM 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BthDNP_572903.3 TP53IP5 <125..>216 CDD:291976 2/5 (40%)
CG13186NP_610725.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1563553at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_113923
Panther 1 1.100 - - P PTHR33638
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.