DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BthD and CG15147

DIOPT Version :10

Sequence 1:NP_572903.3 Gene:BthD / 32317 FlyBaseID:FBgn0030501 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_609854.1 Gene:CG15147 / 35069 FlyBaseID:FBgn0032654 Length:146 Species:Drosophila melanogaster


Alignment Length:136 Identity:46/136 - (33%)
Similarity:71/136 - (52%) Gaps:28/136 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPPKRNKKAEAPIAERDAGEELDPNAPVLYVEHCRSURVFRRRAEELHSALRE--RGLQ---QLQ 60
            ||.||               .|||..||||::|||..:.:|:||..|||:|.|  |.:|   :||
  Fly     1 MPDKR---------------PLDPLQPVLYIDHCRYRQTYRKRALHLHSSLAEALRAIQPRVKLQ 50

  Fly    61 LQLNALGAPRRGAFELSLSA----GGMGKQEQVALWSGLKRGPPRARKFPTVEEVYDRIVGILGD 121
            |::|..|.|..|:||::::.    ....:|   ::|:||:| .|.|.|.|.|:::...:...|..
  Fly    51 LRINDKGPPEDGSFEVAIAPQPTDDSTARQ---SVWTGLRR-MPSASKVPHVDDILTPVCFALKL 111

  Fly   122 QQESKE 127
            :...||
  Fly   112 RDPHKE 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BthDNP_572903.3 PLN02967 144..>240 CDD:215521
CG15147NP_609854.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.