DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BthD and SELENOH

DIOPT Version :10

Sequence 1:NP_572903.3 Gene:BthD / 32317 FlyBaseID:FBgn0030501 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_734467.1 Gene:SELENOH / 280636 HGNCID:18251 Length:122 Species:Homo sapiens


Alignment Length:122 Identity:46/122 - (37%)
Similarity:67/122 - (54%) Gaps:15/122 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PPKRNKKAEA---PIAER-----DAGEELDPNAPVLYVEHCRSURVFRRRAEELHSALRERGLQQ 58
            |..|.:||||   .:||:     :.||.::....|  :|||.| ||:.|.|..|..|||... .:
Human     3 PRGRKRKAEAAVVAVAEKREKLANGGEGMEEATVV--IEHCTSURVYGRNAAALSQALRLEA-PE 64

  Fly    59 LQLQLNALGAPRRGAFELSLSAGGMGKQEQVALWSGLKRGPPRARKFPTVEEVYDRI 115
            |.:::|.. .||||:||::|........|   ||:|:|:||||..|||..:||.:.:
Human    65 LPVKVNPT-KPRRGSFEVTLLRPDGSSAE---LWTGIKKGPPRKLKFPEPQEVVEEL 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BthDNP_572903.3 PLN02967 144..>240 CDD:215521
SELENOHNP_734467.1 CXXU_selWTH 36..119 CDD:274013 37/89 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.