DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment up and TNNT3

DIOPT Version :9

Sequence 1:NP_001162742.1 Gene:up / 32314 FlyBaseID:FBgn0004169 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_006718351.1 Gene:TNNT3 / 7140 HGNCID:11950 Length:274 Species:Homo sapiens


Alignment Length:247 Identity:91/247 - (36%)
Similarity:137/247 - (55%) Gaps:35/247 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 EVVEETREETKP------PQTPAEGEG-DPEFIKRQDQKRSDLDDQLKEYITEWRKQRSKEEDEL 71
            :..||..||.||      |:.| |||. |.:.|:::.|.:..:  :|:..|....:.|.|||:||
Human    44 DTAEEDAEEEKPRPKLTAPKIP-EGEKVDFDDIQKKRQNKDLM--ELQALIDSHFEARKKEEEEL 105

  Fly    72 KKLKEKQAKRKVTRAEEEQKMAQRKKEEEERRVREAEEKKQREIEEKRMRLEEAEKKRQAMLQAM 136
            ..|||:..||:..|||:::..|::   |.||:.|.||||.:||.|:.:.|.|:..||::|:    
Human   106 VALKERIEKRRAERAEQQRIRAEK---ERERQNRLAEEKARREEEDAKRRAEDDLKKKKAL---- 163

  Fly   137 KDKDKKGPNFT--IAKKDAGVLGLSSAAMERNKTKEQLEEEKKISLSFRIKPLAIEGFGEAKLRE 199
               ...|.|::  :||.|          .:|.|.:...|.:||| |:.|.|||.|:..||.|||:
Human   164 ---SSMGANYSSYLAKAD----------QKRGKKQTAREMKKKI-LAERRKPLNIDHLGEDKLRD 214

  Fly   200 KAQELWELIVKLETEKYDLEERQKRQDYDLKELKERQKQQLRHKALKKGLDP 251
            ||:||||.:.:||.:|::..|:.|||.||:..|:.|..|..:|.  ||...|
Human   215 KAKELWETLHQLEIDKFEFGEKLKRQKYDITTLRSRIDQAQKHS--KKAGTP 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
upNP_001162742.1 Troponin 156..>233 CDD:395788 32/76 (42%)
TNNT3XP_006718351.1 Troponin 78..213 CDD:279349 54/157 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156936
Domainoid 1 1.000 50 1.000 Domainoid score I11672
eggNOG 1 0.900 - - E1_KOG3634
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4736
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41072
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11521
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.850

Return to query results.
Submit another query.