DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment up and tnnt1

DIOPT Version :9

Sequence 1:NP_001162742.1 Gene:up / 32314 FlyBaseID:FBgn0004169 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001122167.1 Gene:tnnt1 / 558627 ZFINID:ZDB-GENE-080723-27 Length:268 Species:Danio rerio


Alignment Length:292 Identity:91/292 - (31%)
Similarity:142/292 - (48%) Gaps:59/292 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSD-DEEY-----TSSEEEEVVEET----------------REETKPPQTPAEGEGDPEFIKRQD 43
            ||| :|||     ...||||..||.                .||.:|...|...:..|.  |..:
Zfish     1 MSDVEEEYEEQAEAEEEEEETTEEAGTEQQDYTEYQEEAQEEEEERPRPKPMVPQLAPP--KIPE 63

  Fly    44 QKRSDLDD-----------QLKEYITEWRKQRSKEEDELKKLKEKQAKRKVTRAEEEQKMAQRKK 97
            .:|.|.||           :|:..|....:||.|||:||..||::..:|:..|||:::..|::  
Zfish    64 GERVDFDDIHRKRMEKDLLELQTLIEAHFEQRKKEEEELIGLKDRIERRRFERAEQQRVRAEK-- 126

  Fly    98 EEEERRVREAEEKKQREIEEKRMRLEEAEKKRQAMLQAMKDKDKKGPNFTIAKKDAGVLGLSSAA 162
             |.:|:.|.|||::::|.||.:.|.::..||::.:       ...|.||      .|.  |:.|.
Zfish   127 -ERDRQTRIAEERQRKEDEEAKKRADDEAKKKKVL-------SNMGANF------GGF--LAKAE 175

  Fly   163 MERNKTKEQLEEEKKISLSFRIKPLAIEGFGEAKLREKAQELWELIVKLETEKYDLEERQKRQDY 227
            .:|.|.....|.::| :||.|..||.||...|..||::|||:|..|.:||:||:||.::.|:|.|
Zfish   176 QKRGKRLTGREIKRK-TLSERRAPLGIENMREDALRQRAQEMWNWIYELESEKFDLLDQMKKQKY 239

  Fly   228 DLKELKERQKQQLRH-KALKKGLDPEALTGKY 258
            ::..|..|    :.| :..|||.....:.|::
Zfish   240 EIVVLLNR----ISHAQKFKKGHGKGKVGGRW 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
upNP_001162742.1 Troponin 156..>233 CDD:395788 30/76 (39%)
tnnt1NP_001122167.1 Troponin 75..210 CDD:279349 46/153 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592574
Domainoid 1 1.000 55 1.000 Domainoid score I11115
eggNOG 1 0.900 - - E1_KOG3634
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 122 1.000 Inparanoid score I4719
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11521
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6876
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.880

Return to query results.
Submit another query.