DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment up and tnnt2e

DIOPT Version :9

Sequence 1:NP_001162742.1 Gene:up / 32314 FlyBaseID:FBgn0004169 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_021330700.1 Gene:tnnt2e / 556703 ZFINID:ZDB-GENE-041210-27 Length:326 Species:Danio rerio


Alignment Length:288 Identity:96/288 - (33%)
Similarity:144/288 - (50%) Gaps:72/288 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DDEEYTSSEEEEVVEETREETKP----------PQTPAEGEGDP-EF----IKRQDQKRSDLDDQ 52
            ::|.....:|..|.||..:||||          |:.|   |||. :|    .|||::..|:|...
Zfish    43 EEEPEPEPQEAPVAEEVTDETKPKPKFMPNISAPKIP---EGDKVDFDDIHRKRQEKDLSELQSL 104

  Fly    53 LKEYITEWRKQRSKEEDELKKLKEKQAKRKVTRAEEEQKMAQRKKEEEERRVREAEEKKQREIEE 117
            ::.:..    ||.|:|:||..|..:..||:..|||:::..|::   |:||:.|.||||::||.||
Zfish   105 IEAHFI----QRKKDEEELIALVNRIEKRRGERAEQQRIRAEK---EKERQARLAEEKERREQEE 162

  Fly   118 KRMRLEEAEKKRQAMLQAMKDKDKKGPNFT-----IAKKDAGVLGLSSAAMERNKTKEQLEEEKK 177
            :|.:.:|..||::|:           .|.|     |.:|..|          |...|:|.|.|||
Zfish   163 QRKKHDEDAKKKKAL-----------TNMTHQYGGIQQKGDG----------RKGAKKQTEREKK 206

  Fly   178 IS-LSFRIKPLAIEGFGEAKLREKAQELWELIVKLETEKYDLEERQKRQDYDLK----------- 230
            .. |:.|.|||.|:...|.||:|||.|:|:.:::||.||:||.|:.|||.||.:           
Zfish   207 KKILAERKKPLNIDHLSEDKLKEKASEMWQWMMQLEAEKFDLSEKLKRQKYDCQRSWQGQGWRQA 271

  Fly   231 ELKERQKQQLR---------HKALKKGL 249
            |:..|:.|:|:         |..||..|
Zfish   272 EVNARRIQELQRSRRLYLLHHIQLKSEL 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
upNP_001162742.1 Troponin 156..>233 CDD:395788 34/88 (39%)
tnnt2eXP_021330700.1 Troponin 92..229 CDD:307228 56/164 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592575
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 122 1.000 Inparanoid score I4719
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11521
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.