DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment up and tnnt3

DIOPT Version :9

Sequence 1:NP_001162742.1 Gene:up / 32314 FlyBaseID:FBgn0004169 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_012816190.1 Gene:tnnt3 / 394748 XenbaseID:XB-GENE-482605 Length:277 Species:Xenopus tropicalis


Alignment Length:243 Identity:81/243 - (33%)
Similarity:138/243 - (56%) Gaps:30/243 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DDEEYTSSEEEEVVEETREETKPPQTPA----EGEG-DPEFIKRQDQKRSDLDDQLKEYITEWRK 62
            ::|.|..:||||..||..||...|:..|    |||. |.:.|:::.|.:..:  :|:..|....:
 Frog    38 EEEAYGEAEEEEHGEEYDEEKPKPKLTAPKIPEGEKVDFDDIQKKRQNKDLI--ELQSLIDTHFE 100

  Fly    63 QRSKEEDELKKLKEKQAKRKVTRAEEEQKMAQRKKEEEERRVREAEEKKQREIEEKRMRLEEAEK 127
            .|.|||:||..|||:..||:..|:::::..|::.|   ||:.|.||||.:||.::...|.|:..|
 Frog   101 ARKKEEEELIALKERIEKRRAERSDQQRIRAEKDK---ERQNRLAEEKARREEQDAIRRAEDDMK 162

  Fly   128 KRQAMLQAMKDKDKKGPNFT--IAKKDAGVLGLSSAAMERNKTKEQLEEEKKISLSFRIKPLAIE 190
            |::|:       ...|..::  :||.|          .:|.|.:...|::||| |:.|.|||.::
 Frog   163 KKKAL-------SSMGATYSSYLAKAD----------QKRGKKQTAREQKKKI-LADRRKPLNVD 209

  Fly   191 GFGEAKLREKAQELWELIVKLETEKYDLEERQKRQDYDLKELKERQKQ 238
            ...:.||||||:|:|:.:.:||:||:::.|:.|:|.|::..|..|.::
 Frog   210 HMNDDKLREKAKEMWDWLYQLESEKFEMGEKLKKQKYEITTLHRRVEE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
upNP_001162742.1 Troponin 156..>233 CDD:395788 27/76 (36%)
tnnt3XP_012816190.1 Troponin 82..218 CDD:366404 48/158 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 110 1.000 Inparanoid score I4739
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm48277
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.