DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment up and tnnt2c

DIOPT Version :9

Sequence 1:NP_001162742.1 Gene:up / 32314 FlyBaseID:FBgn0004169 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_852476.1 Gene:tnnt2c / 353248 ZFINID:ZDB-GENE-030520-1 Length:290 Species:Danio rerio


Alignment Length:293 Identity:85/293 - (29%)
Similarity:128/293 - (43%) Gaps:80/293 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDDEEYTSSEEEEVVE-----------------ETREETKPPQTPAEGEGDPE----------- 37
            |.|.||:.:..||||.|                 |.:||.:..|..||...:||           
Zfish     1 MCDTEEFVAEFEEEVKEQEAEEEEEAEEEVKEEAEEKEEVEEEQEEAEEGDEPEETHQEEADDEH 65

  Fly    38 ------------FI------KRQDQKRSDLDD-----------QLKEYITEWRKQRSKEEDELKK 73
                        |:      |..|.::.|.||           :|:..|......|.||||||..
Zfish    66 EAEEDTKPKPKMFVPNIIPPKLPDGEKVDFDDLHRKRVEKDFNELQSLINLHFTTRQKEEDELVA 130

  Fly    74 LKEKQAKRKVTRAEEEQKMAQRKKEEEERRVREAEEKKQREIEEKRMRLEEAEKKRQAMLQAMKD 138
            ||.:..:|:..||::::...:|   :.||:.|.|||:.:||.|..::|.||..:|::.:      
Zfish   131 LKNRIERRRTDRADQQRIRTER---DRERQARLAEERARREEEAAKLRAEEDARKKKIL------ 186

  Fly   139 KDKKGPNFTIAKKDAGVLGLSSAAMERNKTKEQLEEEKKIS-LSFRIKPLAIEGFGEAKLREKAQ 202
             ..||....:.|.|            :.|.|:..|.|||.. |..|.|||.|:...:.||.|||.
Zfish   187 -SNKGYGGFLQKVD------------QKKGKKLTEREKKTKCLLERRKPLNIDHLNQEKLGEKAL 238

  Fly   203 ELWELIVKLETEKYDLEERQKRQDYDLKELKER 235
            :||:.:.:|..||::|.|:.|.|.|::|.|:.|
Zfish   239 DLWKWLNQLHAEKFELGEKLKSQKYEIKVLRNR 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
upNP_001162742.1 Troponin 156..>233 CDD:395788 28/77 (36%)
tnnt2cNP_852476.1 Troponin 101..233 CDD:279349 44/153 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592577
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3634
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 122 1.000 Inparanoid score I4719
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11521
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.