DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment up and Tnnt3

DIOPT Version :9

Sequence 1:NP_001162742.1 Gene:up / 32314 FlyBaseID:FBgn0004169 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_038956836.1 Gene:Tnnt3 / 24838 RGDID:3883 Length:409 Species:Rattus norvegicus


Alignment Length:291 Identity:97/291 - (33%)
Similarity:145/291 - (49%) Gaps:63/291 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDD-----EEYTSSEEEEVVEETREETKPP---QTPAEGEGDPEFIKRQDQKRS---------- 47
            |||:     ||....|||...||.:||...|   |..|..|.:.|..:.:::.|.          
  Rat     1 MSDEETEQVEEQYEEEEEAQEEEVQEEAPEPEEVQEDAVAEEEREEDEEEEKPRPKLTAPKIPEG 65

  Fly    48 ---DLDD-----------QLKEYITEWRKQRSKEEDELKKLKEKQAKRKVTRAEEEQKMAQRKKE 98
               |.||           :|:..|....:.|.|||:||..|||:..||:..|||:::..|::   
  Rat    66 EKVDFDDIQKKRQNKDLMELQALIDSHFEARKKEEEELIALKERIEKRRAERAEQQRIRAEK--- 127

  Fly    99 EEERRVREAEEKKQREIEEKRMRLEEAEKKRQAMLQAMKDKDKKGPNFT--IAKKDAGVLGLSSA 161
            |.||:.|.||||.:||.|:.:.|.|:..||::|:       ...|.|::  :||.|         
  Rat   128 ERERQNRLAEEKARREEEDAKRRAEDDLKKKKAL-------SSMGANYSSYLAKAD--------- 176

  Fly   162 AMERNKTKEQLEEEKKISLSFRIKPLAIEGFGEAKLREKAQELWELIVKLETEKYDLEERQKRQD 226
             .:|.|.:...|.:||| |:.|.|||.|:...:.|||:||:|||:.:.:|||:|::..|:.|||.
  Rat   177 -QKRGKKQTAREMKKKI-LAERRKPLNIDHLSDDKLRDKAKELWDTLYQLETDKFEFGEKLKRQK 239

  Fly   227 YDLKELKERQKQQLRHKALKKGLDPE--ALT 255
            ||:..::.|.:.      |.|.|.|.  |||
  Rat   240 YDIMTVRARVEM------LAKLLPPSGAALT 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
upNP_001162742.1 Troponin 156..>233 CDD:395788 30/76 (39%)
Tnnt3XP_038956836.1 Troponin 76..212 CDD:395788 52/156 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350891
Domainoid 1 1.000 50 1.000 Domainoid score I11374
eggNOG 1 0.900 - - E1_KOG3634
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 122 1.000 Inparanoid score I4652
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45212
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11521
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.