DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment up and Tnnt3

DIOPT Version :9

Sequence 1:NP_001162742.1 Gene:up / 32314 FlyBaseID:FBgn0004169 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001157136.1 Gene:Tnnt3 / 21957 MGIID:109550 Length:272 Species:Mus musculus


Alignment Length:286 Identity:96/286 - (33%)
Similarity:143/286 - (50%) Gaps:59/286 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDD-----EEYTSSEEEEVVEETREETKPP---QTPAEGEGDPEFIKRQDQKRS---------- 47
            |||:     ||....|||...||.:||...|   |..|..|.:.|..:.:::.|.          
Mouse     1 MSDEETEQVEEQYEEEEEAQEEEVQEEAPEPEEVQEDAVAEEEREEDEEEEKPRPKLTAPKIPEG 65

  Fly    48 ---DLDD-----------QLKEYITEWRKQRSKEEDELKKLKEKQAKRKVTRAEEEQKMAQRKKE 98
               |.||           :|:..|....:.|.|||:||..|||:..||:..|||:::..|::   
Mouse    66 EKVDFDDIQKKRQNKDLMELQALIDSHFEARKKEEEELIALKERIEKRRAERAEQQRIRAEK--- 127

  Fly    99 EEERRVREAEEKKQREIEEKRMRLEEAEKKRQAMLQAMKDKDKKGPNFT--IAKKDAGVLGLSSA 161
            |.||:.|.||||.:||.|:.:.|.|:..||::|:       ...|.|::  :||.|         
Mouse   128 ERERQNRLAEEKARREEEDAKRRAEDDMKKKKAL-------SSMGANYSSYLAKAD--------- 176

  Fly   162 AMERNKTKEQLEEEKKISLSFRIKPLAIEGFGEAKLREKAQELWELIVKLETEKYDLEERQKRQD 226
             .:|.|.:...|.:||| |:.|.|||.|:...:.|||:||:|||:.:.:|||:|::..|:.|||.
Mouse   177 -QKRGKKQTAREMKKKI-LAERRKPLNIDHLSDDKLRDKAKELWDTLYQLETDKFEFGEKLKRQK 239

  Fly   227 YDLKELKERQKQQLRHK----ALKKG 248
            ||:..|:.|..|..:|.    |..||
Mouse   240 YDITTLRSRIDQAQKHSKKAGATAKG 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
upNP_001162742.1 Troponin 156..>233 CDD:395788 30/76 (39%)
Tnnt3NP_001157136.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..75 21/73 (29%)
Troponin 76..211 CDD:366404 51/155 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..193 31/99 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 248..272 6/18 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847338
Domainoid 1 1.000 50 1.000 Domainoid score I11585
eggNOG 1 0.900 - - E1_KOG3634
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 120 1.000 Inparanoid score I4757
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43143
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11521
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6876
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.880

Return to query results.
Submit another query.