DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment up and Tnnt2

DIOPT Version :9

Sequence 1:NP_001162742.1 Gene:up / 32314 FlyBaseID:FBgn0004169 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_006529446.2 Gene:Tnnt2 / 21956 MGIID:104597 Length:333 Species:Mus musculus


Alignment Length:311 Identity:100/311 - (32%)
Similarity:145/311 - (46%) Gaps:85/311 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SDDEEYTSSEEEEVVEETREETKPPQTPAEGEGDPE----------------------------- 37
            |::||   .|:||.|||  ||....:...|||.:.|                             
Mouse    53 SEEEE---DEQEEAVEE--EEAGGAEPEPEGEAETEEANVEEVGPDEEAKDAEEGPVEDTKPKPS 112

  Fly    38 --FI------KRQDQKRSDLDD-----------QLKEYITEWRKQRSKEEDELKKLKEKQAKRKV 83
              |:      |..|.:|.|.||           :|:..|....:.|.|||:||..||::..||:.
Mouse   113 RLFMPNLVPPKIPDGERVDFDDIHRKRVEKDLNELQTLIEAHFENRKKEEEELISLKDRIEKRRA 177

  Fly    84 TRAEEEQKMAQRKKEEEERRVREAEEKKQREIEEKRMRLEEAEKKRQAMLQAMKDKDKKGPNFTI 148
            .|||:::   .|.:.|:||:.|.|||:.:||.||.|.:.|:..:|::|:...|        :|  
Mouse   178 ERAEQQR---IRNEREKERQNRLAEERARREEEENRRKAEDEARKKKALSNMM--------HF-- 229

  Fly   149 AKKDAGVLGLSSAAMERNKTKEQLEEEKKIS-LSFRIKPLAIEGFGEAKLREKAQELWELIVKLE 212
                 |......|..||...|.|.|.|||.. |:.|.|.|||:...|.:|||||:|||:.|..||
Mouse   230 -----GGYIQKQAQTERKSGKRQTEREKKKKILAERRKALAIDHLNEDQLREKAKELWQSIHNLE 289

  Fly   213 TEKYDLEERQKRQDYDLKELKER----QK-QQLRHKALKKGLDPEALTGKY 258
            .||:||:|:.|:|.|::..|:.|    || .:.|.||        .:||::
Mouse   290 AEKFDLQEKFKQQKYEINVLRNRINDNQKVSKTRGKA--------KVTGRW 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
upNP_001162742.1 Troponin 156..>233 CDD:395788 35/77 (45%)
Tnnt2XP_006529446.2 Troponin 138..276 CDD:366404 51/155 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847340
Domainoid 1 1.000 50 1.000 Domainoid score I11585
eggNOG 1 0.900 - - E1_KOG3634
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 120 1.000 Inparanoid score I4757
Isobase 1 0.950 - 1 Normalized mean entropy S6639
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43143
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11521
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.840

Return to query results.
Submit another query.