DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment up and Tnnt1

DIOPT Version :9

Sequence 1:NP_001162742.1 Gene:up / 32314 FlyBaseID:FBgn0004169 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_017177600.1 Gene:Tnnt1 / 21955 MGIID:1333868 Length:302 Species:Mus musculus


Alignment Length:285 Identity:97/285 - (34%)
Similarity:144/285 - (50%) Gaps:51/285 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDDEEYTSSEEEEVVEETREETKPPQTP---AEGEGD---------PEFI--KRQDQKRSDLDD 51
            |||.||....||:...||..||.:.|:.|   ||.|.:         |..|  |..:.:|.|.||
Mouse    41 MSDTEEQEYEEEQAEDEEAVEEEEAPEEPEPVAEREEERPKPSRPVVPPLIPPKIPEGERVDFDD 105

  Fly    52 -----------QLKEYITEWRKQRSKEEDELKKLKEKQAKRKVTRAEEEQKMAQRKKEEEERRVR 105
                       :|:..|....:||.|||:||..||::..:|:..|||:::   .|.::|.||:.:
Mouse   106 IHRKRMEKDLLELQTLIDVHFEQRKKEEEELIALKDRIERRRAERAEQQR---FRTEKERERQAK 167

  Fly   106 EAEEKKQREIEEKRMRLEEAEKKRQAMLQAMKDKDKKGPNFTIAKKDAGVLGLSSAAMERNKTKE 170
            .||||.::|.||.:.|.|:..||::.:       ...|.:|      .|.|    ...|:.:.|.
Mouse   168 LAEEKMRKEEEEAKKRAEDDAKKKKVL-------SNMGAHF------GGYL----VKAEQKRGKR 215

  Fly   171 QLEEEKKIS-LSFRIKPLAIEGFGEAKLREKAQELWELIVKLETEKYDLEERQKRQDYDLKELKE 234
            |...|.|:. ||.|.|||.|:..||.:||||||||.|.|.:||:||:||.|:.|:|.|::..|..
Mouse   216 QTGREMKLRILSERKKPLNIDYMGEDQLREKAQELSEWIHQLESEKFDLMEKLKQQKYEINVLYN 280

  Fly   235 RQKQQLRH-KALKKGLDPEALTGKY 258
            |    :.| :..:||.....:.|::
Mouse   281 R----ISHAQKFRKGAGKGRVGGRW 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
upNP_001162742.1 Troponin 156..>233 CDD:395788 35/77 (45%)
Tnnt1XP_017177600.1 Troponin 109..245 CDD:366404 49/155 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847339
Domainoid 1 1.000 50 1.000 Domainoid score I11585
eggNOG 1 0.900 - - E1_KOG3634
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 120 1.000 Inparanoid score I4757
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43143
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11521
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6876
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.880

Return to query results.
Submit another query.