DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment up and tni-4

DIOPT Version :9

Sequence 1:NP_001162742.1 Gene:up / 32314 FlyBaseID:FBgn0004169 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_500741.2 Gene:tni-4 / 177295 WormBaseID:WBGene00006586 Length:194 Species:Caenorhabditis elegans


Alignment Length:200 Identity:55/200 - (27%)
Similarity:90/200 - (45%) Gaps:33/200 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 EEERRVREAEEKKQREIEEKRMRLEEAEKKRQAMLQAMKDKDKKGPNFTIAKKDAGVLGLSSAAM 163
            :|.|::.|.|.||    ||.|.|||||.:.::|         |||......||....|.:..||.
 Worm     7 DEARKMAERERKK----EEVRKRLEEASRMKKA---------KKGFLTPERKKKLRKLLMMKAAE 58

  Fly   164 ERNKTKEQLEEEKKISLSFRIKPLAIEGFGEAKLREKAQELWELIVKLETEKYDLEERQKRQDYD 228
            :..:.:...|:|::..|..||.||. :...|..|.....|:.|.::.||:|.||:....:::|::
 Worm    59 DLKQQQMLKEQERQRILQERIIPLP-DLDNEDDLEAVYDEIRERLIDLESENYDVSYIVRQKDFE 122

  Fly   229 LKE----------------LKERQKQQLRHKALKKGLDPEALTGKYPPKIQVASKYERRVDTRSY 277
            :.|                ||:..|.:.:...|||   .||....:..:::|..|.|..:|....
 Worm   123 INELTIAVNDLRGKFVKPTLKKVSKTEGKFDKLKK---KEATKVDFRAQLKVVDKNEFALDEEDT 184

  Fly   278 DDKKK 282
            :.|:|
 Worm   185 EKKEK 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
upNP_001162742.1 Troponin 156..>233 CDD:395788 21/92 (23%)
tni-4NP_500741.2 Troponin 45..172 CDD:279349 31/130 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.