DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment up and Tnnt1

DIOPT Version :9

Sequence 1:NP_001162742.1 Gene:up / 32314 FlyBaseID:FBgn0004169 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_599215.2 Gene:Tnnt1 / 171409 RGDID:621852 Length:261 Species:Rattus norvegicus


Alignment Length:284 Identity:97/284 - (34%)
Similarity:143/284 - (50%) Gaps:50/284 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDDEEYTSSEEEEVVEETREETKP--PQTPAEGEGD---------PEFI--KRQDQKRSDLDD- 51
            |||.||....||:...||..||..|  |:..||.|.:         |..|  |..:.:|.|.|| 
  Rat     1 MSDTEEQEYEEEQAEDEEAVEEEAPEEPEPVAEREEERPKPSRPVVPPLIPPKIPEGERVDFDDI 65

  Fly    52 ----------QLKEYITEWRKQRSKEEDELKKLKEKQAKRKVTRAEEEQKMAQRKKEEEERRVRE 106
                      :|:..|....:||.|||:||..||::..:|:..|||:::   .|.::|.||:.:.
  Rat    66 HRKRMEKDLLELQTLIDVHFEQRKKEEEELIALKDRIERRRAERAEQQR---FRTEKERERQAKL 127

  Fly   107 AEEKKQREIEEKRMRLEEAEKKRQAMLQAMKDKDKKGPNFTIAKKDAGVLGLSSAAMERNKTKEQ 171
            ||||.::|.||.:.|.|:..||::.:       ...|.:|      .|.|    ...|:.:.|.|
  Rat   128 AEEKMRKEEEEAKKRAEDDAKKKKVL-------SNMGAHF------GGYL----VKAEQKRGKRQ 175

  Fly   172 LEEEKKIS-LSFRIKPLAIEGFGEAKLREKAQELWELIVKLETEKYDLEERQKRQDYDLKELKER 235
            ...|.|:. ||.|.|||.|:..||.:||||||||.|.|.:||:||:||.|:.|:|.|::..|..|
  Rat   176 TGREMKLRILSERKKPLNIDYMGEDQLREKAQELSEWIHQLESEKFDLMEKLKQQKYEINVLYNR 240

  Fly   236 QKQQLRH-KALKKGLDPEALTGKY 258
                :.| :..:||.....:.|::
  Rat   241 ----ISHAQKFRKGAGKGRVGGRW 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
upNP_001162742.1 Troponin 156..>233 CDD:395788 35/77 (45%)
Tnnt1NP_599215.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..61 20/59 (34%)
Troponin 68..204 CDD:395788 49/155 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 108..152 18/46 (39%)
Troponin 179..>237 CDD:395788 31/57 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350892
Domainoid 1 1.000 50 1.000 Domainoid score I11374
eggNOG 1 0.900 - - E1_KOG3634
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 122 1.000 Inparanoid score I4652
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45212
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11521
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.850

Return to query results.
Submit another query.